KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_12410Help
Entry
PACID_12410       CDS       T02345                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00010  Glycolysis / Gluconeogenesis
pbo00052  Galactose metabolism
pbo00500  Starch and sucrose metabolism
pbo00520  Amino sugar and nucleotide sugar metabolism
pbo00521  Streptomycin biosynthesis
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01120  Microbial metabolism in diverse environments
pbo01130  Biosynthesis of antibiotics
pbo01200  Carbon metabolism
Module
pbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pbo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PACID_12410
   00052 Galactose metabolism
    PACID_12410
   00500 Starch and sucrose metabolism
    PACID_12410
   00520 Amino sugar and nucleotide sugar metabolism
    PACID_12410
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PACID_12410
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PACID_12410
Enzymes [BR:pbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PACID_12410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Hydant_A_N FGGY_N DEDD_Tnp_IS110 Fumerase
Motif
Other DBs
NCBI-ProteinID: AFV89063
UniProt: K7RVQ3
Position
1355853..1356938
Genome map
AA seq 361 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDEQGTILRRLKRPTPSHSPEAVENAIVESVAELSVGLGVGAV
GIGAAGWVDTEQALVRFSPHLAWRNEPLRDRLATRISVPVLVDNDANAAAWAEYRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDAKALIAEGSPRAQGLLDHVAGRDPDQLIGPDVTAAAVDGDATAIELIADVGTW
LGKGMAGLGAALDPDLFVIGGGVSAAGELLLGPARTAFARNLTGRGFRPLAEIEHARFGP
DAGLIGAADLARHSIAEPPGPARGFWPRRRHPRRTVRRRPILHTFTSGFGAPVEQGSEPR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgctcagcgtcggcatcgacatcggcggcacgaaagtggccgccggtgtggtcgatgag
caggggacgatcctccgcagactcaagcgccccaccccctcgcacagccccgaggcggtg
gagaacgccatcgtcgagtcggtcgccgagctgtccgtggggctgggcgtcggcgccgtc
ggcatcggggcggccggctgggtcgacaccgagcaggcgctggtgaggttctcgccgcac
ctggcatggcgcaacgagccgcttcgcgaccgcctggccacccgcatctccgtcccggtg
ctcgtcgacaacgacgccaacgcggcggcctgggccgagtaccgcttcggcgccgggcag
gggtcccgggtcatggtgtgcctcaccctgggaaccggcatcggcggcgccctggtgatc
aacggccggatgttccgcggccgctatgggatggccggagagttcggacatatgacagtc
gtgcctgacggccactggtgcccctgcggcaaccgcggctgctgggagcagtacgcgtcg
ggcaactccctggtccgcgacgccaaggctctcatcgccgagggatctccgcgcgcccag
ggtctcctcgaccacgtcgccggtcgggaccccgaccagctcatcggccccgacgtcacc
gctgccgccgtcgacggcgatgccaccgcgatcgaactcatcgcggacgtcggcacctgg
ctcggcaagggcatggccgggctcggcgcagcactggaccccgacctcttcgtcatcggc
ggaggtgtcagcgcggccggggagctcctcctcgggccggcccggacggccttcgccaga
aacctcaccgggcggggattccgtcccctcgccgagatcgagcacgcccgattcggcccc
gacgcagggctcatcggcgccgccgacctggcgcgtcactccatcgccgagccccctggc
ccggcccgcggattctggccgcgccggcgtcatcccaggcggaccgtccgcaggcgaccg
atcctccataccttcacgagcggtttcggcgctccggtcgagcagggttcagagcctcgc
ccgtga

DBGET integrated database retrieval system