KEGG   Propionibacterium acidipropionici: PACID_12410Help
Entry
PACID_12410       CDS       T02345                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PACID_12410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PACID_12410
   00052 Galactose metabolism
    PACID_12410
   00500 Starch and sucrose metabolism
    PACID_12410
   00520 Amino sugar and nucleotide sugar metabolism
    PACID_12410
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PACID_12410
   00524 Butirosin and neomycin biosynthesis
    PACID_12410
Enzymes [BR:pbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PACID_12410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355853..1356938
Genome map
AA seq 361 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDEQGTILRRLKRPTPSHSPEAVENAIVESVAELSVGLGVGAV
GIGAAGWVDTEQALVRFSPHLAWRNEPLRDRLATRISVPVLVDNDANAAAWAEYRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDAKALIAEGSPRAQGLLDHVAGRDPDQLIGPDVTAAAVDGDATAIELIADVGTW
LGKGMAGLGAALDPDLFVIGGGVSAAGELLLGPARTAFARNLTGRGFRPLAEIEHARFGP
DAGLIGAADLARHSIAEPPGPARGFWPRRRHPRRTVRRRPILHTFTSGFGAPVEQGSEPR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgctcagcgtcggcatcgacatcggcggcacgaaagtggccgccggtgtggtcgatgag
caggggacgatcctccgcagactcaagcgccccaccccctcgcacagccccgaggcggtg
gagaacgccatcgtcgagtcggtcgccgagctgtccgtggggctgggcgtcggcgccgtc
ggcatcggggcggccggctgggtcgacaccgagcaggcgctggtgaggttctcgccgcac
ctggcatggcgcaacgagccgcttcgcgaccgcctggccacccgcatctccgtcccggtg
ctcgtcgacaacgacgccaacgcggcggcctgggccgagtaccgcttcggcgccgggcag
gggtcccgggtcatggtgtgcctcaccctgggaaccggcatcggcggcgccctggtgatc
aacggccggatgttccgcggccgctatgggatggccggagagttcggacatatgacagtc
gtgcctgacggccactggtgcccctgcggcaaccgcggctgctgggagcagtacgcgtcg
ggcaactccctggtccgcgacgccaaggctctcatcgccgagggatctccgcgcgcccag
ggtctcctcgaccacgtcgccggtcgggaccccgaccagctcatcggccccgacgtcacc
gctgccgccgtcgacggcgatgccaccgcgatcgaactcatcgcggacgtcggcacctgg
ctcggcaagggcatggccgggctcggcgcagcactggaccccgacctcttcgtcatcggc
ggaggtgtcagcgcggccggggagctcctcctcgggccggcccggacggccttcgccaga
aacctcaccgggcggggattccgtcccctcgccgagatcgagcacgcccgattcggcccc
gacgcagggctcatcggcgccgccgacctggcgcgtcactccatcgccgagccccctggc
ccggcccgcggattctggccgcgccggcgtcatcccaggcggaccgtccgcaggcgaccg
atcctccataccttcacgagcggtttcggcgctccggtcgagcagggttcagagcctcgc
ccgtga

DBGET integrated database retrieval system