KEGG   Propionibacterium acidipropionici: PACID_12410Help
Entry
PACID_12410       CDS       T02345                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:pbo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pbo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pbo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pbo00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pbo00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pbo00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355853..1356938
Genome map
AA seq 361 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDEQGTILRRLKRPTPSHSPEAVENAIVESVAELSVGLGVGAV
GIGAAGWVDTEQALVRFSPHLAWRNEPLRDRLATRISVPVLVDNDANAAAWAEYRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDAKALIAEGSPRAQGLLDHVAGRDPDQLIGPDVTAAAVDGDATAIELIADVGTW
LGKGMAGLGAALDPDLFVIGGGVSAAGELLLGPARTAFARNLTGRGFRPLAEIEHARFGP
DAGLIGAADLARHSIAEPPGPARGFWPRRRHPRRTVRRRPILHTFTSGFGAPVEQGSEPR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgctcagcgtcggcatcgacatcggcggcacgaaagtggccgccggtgtggtcgatgag
caggggacgatcctccgcagactcaagcgccccaccccctcgcacagccccgaggcggtg
gagaacgccatcgtcgagtcggtcgccgagctgtccgtggggctgggcgtcggcgccgtc
ggcatcggggcggccggctgggtcgacaccgagcaggcgctggtgaggttctcgccgcac
ctggcatggcgcaacgagccgcttcgcgaccgcctggccacccgcatctccgtcccggtg
ctcgtcgacaacgacgccaacgcggcggcctgggccgagtaccgcttcggcgccgggcag
gggtcccgggtcatggtgtgcctcaccctgggaaccggcatcggcggcgccctggtgatc
aacggccggatgttccgcggccgctatgggatggccggagagttcggacatatgacagtc
gtgcctgacggccactggtgcccctgcggcaaccgcggctgctgggagcagtacgcgtcg
ggcaactccctggtccgcgacgccaaggctctcatcgccgagggatctccgcgcgcccag
ggtctcctcgaccacgtcgccggtcgggaccccgaccagctcatcggccccgacgtcacc
gctgccgccgtcgacggcgatgccaccgcgatcgaactcatcgcggacgtcggcacctgg
ctcggcaagggcatggccgggctcggcgcagcactggaccccgacctcttcgtcatcggc
ggaggtgtcagcgcggccggggagctcctcctcgggccggcccggacggccttcgccaga
aacctcaccgggcggggattccgtcccctcgccgagatcgagcacgcccgattcggcccc
gacgcagggctcatcggcgccgccgacctggcgcgtcactccatcgccgagccccctggc
ccggcccgcggattctggccgcgccggcgtcatcccaggcggaccgtccgcaggcgaccg
atcctccataccttcacgagcggtttcggcgctccggtcgagcagggttcagagcctcgc
ccgtga

DBGET integrated database retrieval system