KEGG   Propionibacterium acidipropionici: PACID_13280Help
Entry
PACID_13280       CDS       T02345                                 

Definition
Beta-N-acetylglucosaminidase (Putative secreted protein) (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PACID_13280
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PACID_13280
Enzymes [BR:pbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PACID_13280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1452343..1453995
Genome map
AA seq 550 aa AA seqDB search
MSASTASDETATPEEMLGRMSLAEKVGQVMMCEVYGTDPDRAHEGNRRRFGVDTAAEAVR
LLHLGSAIYFRWTDSFADGPQALAGLSVRLQEIARQDCGTGMLIATDQEQGPSSRFGPPA
TQFPGAMALGAVGSTGLARGAAAATGEELAAVGINVDFAPDADVNINPGSPVIGVRSFGS
DPGQVARMVAAQVAGYQEDAGISACAKHFPGHGDTSTDSHTGLPVIGHSRRRWEQVDAPP
FLAAIEAGVDLVMTAHIRFPGLEPDGHPATLSRRVLTDLLRTELGFDGVIITDSLQMSGV
RQDHDDAEVAVRALEAGADMILMPPDPVAARDAVVAAVTGGRLASEVLDAKVLRVLRLKA
RRGLLGGPSSPARPDLSVVGSAAHRALADEITGAAVTLLREGAAPLPVRPAGRRVLVCGW
GEAENADLVDLLADRLRGLGAVATGAQSGQDPSAGMRESLAAAASDQDLVVCLTHDVTAS
SAQADLVGRLAASGTPTVVVSVGVPYDVAHLPATVTQFAAYSSAAPVAGAIARLLTGDLR
ASGVMPVGIR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctcgacggcctccgatgagacggcgacccccgaggagatgctgggacggatg
agcctggccgagaaggtcggccaggtgatgatgtgcgaggtctacggcaccgatccggac
cgggcccatgagggcaatcggcgccgcttcggggtggacaccgcggcggaggcggtacgg
ctactgcacctgggctcggcgatctacttccgatggaccgactccttcgccgacggcccc
caggccctggcggggctgtccgtccggctccaggagatcgcccgccaggactgcgggacg
gggatgctcatcgccaccgaccaggagcagggcccgtccagccgcttcgggccgccggcc
acccagttccctggggcgatggccctaggcgcggtgggtagcaccggcctggcgaggggt
gccgcggcggccaccggggaggaactggcggcggtcggtatcaacgtggatttcgccccc
gacgccgacgtcaacatcaaccccggcagtcctgtcatcggggtgcgctccttcggctcc
gacccgggccaggtggcccggatggtggccgcccaggtggccggctaccaggaggatgcc
ggcatcagcgcgtgcgcaaagcacttcccgggacacggcgacacctcgaccgactcccac
accggcctgccggtgatcggccacagccgacgccgttgggagcaggtcgatgcaccgccc
ttcctcgccgcgatcgaggccggggtcgatctcgtgatgaccgcccatatccggttcccg
gggctggagcccgacgggcatccggcgacgctgagccgtcgggtgctcacagacctgctg
cgcaccgagctgggcttcgacggggtcatcatcaccgactctctccagatgagcggggtg
cggcaggaccatgacgacgccgaggtcgcggtgcgcgccctggaggccggcgcggacatg
atcctcatgccccccgatcccgtcgcggcccgggacgccgtggtggcggcggtcaccggc
ggccggctggcgtccgaggtgctggacgccaaggtgctgcgggtgctgcgtctcaaggcc
cggcgcggattgctcggcgggccgtcgtctcccgcacgtccggatctgtcggtggtcggt
tcggcggcgcatcgcgcgctggctgatgagatcaccggggccgccgtcacgctcctccgg
gaaggggccgcgccgctcccggtccggcccgccggccggagggtgctggtgtgcgggtgg
ggagaggccgagaacgccgacctggtcgacctgctggccgaccgtctgcgggggctcggt
gcggtggcgaccggcgcgcagagcggccaggacccctcggccgggatgcgggagtcgctg
gcggcggccgccagcgaccaggacctggtggtctgcctcacccacgatgtcaccgcgtct
tcggcccaggcggatctggtgggccggctggccgcatcggggacgccgacagtggtggtc
tcggtcggggtgccctacgacgtcgcgcatctgcccgccacggtgacgcagttcgccgcc
tactcctcggccgccccggtggcaggtgcgatcgcccggctgctgaccggggacctgcgg
gcctccggagtcatgccggtcgggatccgatag

DBGET integrated database retrieval system