KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_18100Help
Entry
PACID_18100       CDS       T02345                                 

Gene name
hisX
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00340  Histidine metabolism
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01230  Biosynthesis of amino acids
Module
pbo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PACID_18100 (hisX)
Enzymes [BR:pbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PACID_18100 (hisX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFV89614
UniProt: K7RNN4
Position
complement(1918323..1919627)
Genome map
AA seq 434 aa AA seqDB search
MMRTVDLTSAEPSDYRDVVPRADFDVDSAMETIIPVCQAVKERGEEALREFSRRFDHVEP
EHLRVPPEELSRAAEQLDPKLRSAFTESINRRREVCESIEREFDADPVEVAPGATVGQRH
IPVSRVGLYVPGGFAPLASSVIMNVVPAQVAGVESIAVASPPQAEFGGLPHPSILALCEI
LGVDEVYAVGGAQAVAMFAHGVEGLCPRVDMVTGPGNIYVVAAKRHLRGVVGIDSEAGPT
EIGVLADATADPRLVAADLMSQAEHDPMAAAVLVTDSPELAARVPVELEEMVSKTLHAER
IRTSLGSRQSAIVMVRDIEQGLAVVNGYGAEHLEIQTAKAASVAARVRNAGAIFVGPWSP
VSLGDYSAGSTHVLPTGGSARYSSGLSVRSFMRAVHVIDYSQEALASLSASVEHFALAEN
LPGHANAITVRRSR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgaaccgtggatctcacctctgccgaaccgtccgactaccgcgacgtggtgccc
cgggcagatttcgatgtcgactccgcgatggagacgatcatccccgtctgccaggccgtc
aaggagcgcggcgaggaggcgctccgcgagttcagccggaggttcgatcatgtggagccc
gagcatctgagggtgccgcccgaggagctgtcgagggcggccgagcagctcgacccgaag
ctgcgcagcgccttcaccgagtccatcaaccgacgccgcgaggtctgcgagtccatcgag
cgtgagttcgacgccgacccggtggaggtggcgccgggcgccacggtgggccagcgccac
atcccggtgagccgggtcgggctgtacgtgccgggcggattcgccccgctggcctccagc
gtcatcatgaacgtggtgcccgctcaggtcgccggcgtggagtccatcgcggtggcctcc
ccgccccaggccgagttcgggggtctgccgcaccccagcatcctggcgctgtgcgagatc
ctcggcgtcgacgaggtctacgcggtcggcggggcccaggcggtcgcgatgttcgcccac
ggggtcgaggggctgtgtccccgggtggacatggtcaccggaccagggaacatctacgtc
gtggccgccaagcggcacctgcgcggggtggtcggtatcgactcggaggccgggcccacc
gagatcggggtgctggccgacgccaccgccgatccccggctggtggccgccgacctcatg
agccaggccgagcacgacccgatggccgccgccgtgctcgtcaccgactccccggagctg
gcagccagggtgcccgtcgagctcgaggagatggtctcgaagacccttcacgccgagcgg
atccgcacctccctgggctcccggcagtcggcgatcgtgatggtgcgcgacatcgagcag
gggctggccgtggtcaacggatacggcgccgagcacctggagatccagaccgcgaaggcg
gcctcggtggcggcccgggtccgcaacgccggcgcgatcttcgtcgggccgtggtccccg
gtgtcgctgggcgactactcggccggatccacccacgtgctgcccaccggcgggtcggcg
cggtactcctcggggctgtcggtgcgcagcttcatgcgcgccgtccacgtcatcgactac
agccaggaggccctggcctccctgtcggcctcggtggagcacttcgccctggccgagaac
ctgccgggccacgccaatgccatcaccgtgaggagaagccgatga

DBGET integrated database retrieval system