KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_18250Help
Entry
PACID_18250       CDS       T02345                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01130  Biosynthesis of antibiotics
pbo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PACID_18250 (trpC)
Enzymes [BR:pbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PACID_18250 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh ThiG DHO_dh Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AFV89629
UniProt: K7RNP6
Position
complement(1940125..1940934)
Genome map
AA seq 269 aa AA seqDB search
MSVTPRQTGTVLDEIIAGVLTDLRERQELVEEASLREAVELIDPPLDPQRALRAEGLSVI
AEVKRASPSKGHLAEIPDPAVLARQYEAGGATAISVLTEQRRFHGSLADLDAVRKDVSVP
VLRKDFVVTEYQVLEARAHGADLVLLIVAALDDPELETLYRLTRRLGMTALVEVHTPEEA
RRAAGLGASVVGVNARNLKTLEVDPGNFSALVSQLPDQAVKIAESGILTVDDAVAAHRAG
ADAILVGEALVRSGDPAAFISAIREATAS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcacacccagacagaccggaaccgtgctggacgagatcatcgccggggtgctg
accgacctgcgggaacgtcaggagctggtcgaggaggcgagcctgcgggaggccgtcgag
ctcatcgatccgccgctggacccccagcgggcgctgcgcgccgaaggcctgtcggtcatc
gccgaggtcaagcgagccagcccctccaaaggccacctcgccgagatccccgaccccgcc
gtgctcgcccggcagtacgaggcgggcggggcgaccgcgatcagcgtgctcaccgagcag
cgccgtttccacggctccctggccgatctcgacgcggtgcgcaaggacgtctccgtcccg
gtgctgcgcaaggatttcgtcgtcaccgaataccaggtgctggaggcccgggcacacggc
gccgacctggtcctgctcatcgtcgccgccctggacgaccccgaactggagaccctctac
cggttgacccgccgtctcggcatgacggccctggtggaggtccacacccccgaggaggcc
cgtcgtgccgccggcctgggggcgtcggtggtcggcgtcaacgcccgcaacctcaagacc
ctcgaggtggatcccggcaacttctccgcgctggtctcccagctgccggaccaggcggtc
aagatcgccgagtcggggatcctcaccgtcgacgacgccgtcgccgcccatcgtgccggg
gccgacgcgatcctggtcggcgaggccctcgtccgctccggagatccggcggccttcatc
tccgccatccgcgaggcgacagcctcatga

DBGET integrated database retrieval system