KEGG   Propionibacterium acidipropionici: PACID_20070Help
Entry
PACID_20070       CDS       T02345                                 

Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PACID_20070
Enzymes [BR:pbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PACID_20070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2134211..2136139
Genome map
AA seq 642 aa AA seqDB search
MPDLIPVAAGHLAPFCRTGVLEAADVHLARLICRAGGEPSPDVELAAALTVRELRLGSVQ
MDPATIRRDVARQILDPAVVAAAGPGELAALEEFKALSWPDPSAWLEELGVSPAVAGPMA
PANRRALRLDEGILHLERYWQDEQQVAQLMAGLADDPPDELSDHLVEAAVKSVGGALRQA
GTVLDPAQIQAAERACRHRLTVLAGGPGTGKTTTVCTILAVLARAAGDPGPVRLAAPSGK
AAARLRDAVGQVAAGLPEEFRPASVEATTVHALLGSRGPGRGFSHDARNPLAAGVVIVDE
ASMLSLPMAARLLEAVGPSTRLVLVGDPGQLVSVDAGSVLADVVASASGLGPERLPVTTL
TSNHRSGGAIARLAEAVRRGDQDAVMAVLDGDDSTVGFIDADAAGVGLQDLPEVAEQIRS
VAADTLEAVNRGDDEEALRLVDEHRLLCAHRQGPYGVEAWSRQMDSALSEALPGLGRGRW
VVGEPVIVNRNMRQLEINNGDCGVVVTEDPVPTVVLPGGSGAPRRLPCALVASLRPLQAM
TVHKAQGSQFNRVTVILPPPDSPLLTRELIYTAITRARRGLTVVGTRESVSRAVAQPSRR
RSGLARLWERRSQRDRQVGAGLGDGQAVGEPGLDEAAGDGHR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgatctcatcccggtggcagctggacatctggcccccttctgccgcaccggcgtg
ctggaggccgccgatgtccacctggcccgactcatctgccgggccggcggggagccctcc
cccgacgtcgagctcgccgccgccctgaccgtcagggagctgcgactcggatctgtccag
atggatccggcgaccatccgccgggacgtcgcccgtcagatcctcgacccggccgtggtg
gccgccgccggccccggggagctggccgccctcgaagagttcaaggccctgtcgtggccc
gatccgtccgcctggctcgaggaactgggggtcagcccggcggttgcgggcccgatggcc
ccggccaaccggcgggccctgcgactcgacgagggcatcctccacctcgagcggtactgg
caggacgagcagcaggtggcccagctgatggccggcctggcggacgaccctcccgacgag
ctctccgatcacctcgtcgaggccgccgtcaaatcggtgggtggcgccctgaggcaggcc
ggcaccgttctggaccccgcccagatccaggccgcggagcgggcctgccggcaccgcctc
accgtcctggcgggaggaccgggcaccgggaagacgaccacggtctgcacgatcctcgcg
gtgctcgcccgggcggccggcgatccggggccggtccggctggcggctcccagcggaaag
gccgcagccaggctgcgagacgccgtcggccaggtggcggccggcctgcccgaggaattc
cggcctgcctccgtcgaggccaccacggtgcatgcgctcctcgggtcccgggggcccggc
agaggcttcagccacgacgcccgcaaccccctggcggccggggtggtgatcgtcgacgag
gcgtcgatgctgtccctgccgatggccgcccggctgttggaggccgtcggcccctcgacc
aggctggtgctggtcggcgatcccggccagctcgtctcggtggacgccggcagcgtcctg
gccgacgtcgtcgcctccgcctcgggtctgggccccgagcggctgccggtcaccaccctc
accagcaatcaccgctccggcggcgccatcgcccggctcgccgaggcggtgcgccgcggg
gaccaggatgcggtgatggccgtgctcgacggcgacgactcgacggtgggattcatcgac
gcggatgcggccggcgtcgggctgcaggatcttcccgaggtggccgagcagatccggtcg
gtggccgccgacaccctcgaggcggtgaaccgcggcgacgacgaggaggccctgaggctg
gtggacgagcaccggctgctgtgcgcccaccgtcaggggccctacggggtcgaggcgtgg
tcccgacagatggactccgccctgtcggaggccctgcccgggctgggccggggccgctgg
gtggtcggcgagccggtcatcgtcaaccggaatatgcgccagctggagatcaacaacggc
gactgcggggtcgtggtgaccgaggatccggtgcccaccgtcgttctgccgggcggctcg
ggtgccccgcggcgactgccctgcgccctggtggcgtcgctgcgtccccttcaggcgatg
accgtccacaaggctcagggctcccagttcaaccgtgtgacggtgatcctgccccctccc
gactcgccgctgctgacccgggagctgatctacaccgccatcacccgggccagacgcggc
ctgacggtggtgggcacccgcgagtcggtgagccgtgcggtggcccagccgtcccgacga
cgctcagggctggcccggctctgggagcgccgctcccagcgggaccgacaggtcggcgcc
ggactcggggacgggcaggcggtcggcgagccaggcctcgatgaggctgcgggcgatgga
catcggtga

DBGET integrated database retrieval system