KEGG   Propionibacterium acidipropionici: PACID_20570Help
Entry
PACID_20570       CDS       T02345                                 

Gene name
pdp
Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PACID_20570 (pdp)
Enzymes [BR:pbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PACID_20570 (pdp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2189468..2190742
Genome map
AA seq 424 aa AA seqDB search
MTAQFDVVDLIRSKRSGLRLDDEQIDWLLDAYTSGFVADEQMSAMAMAIFFQGLDHRELS
RWTAAMIASGERLDFSGLSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGH
TGGTLDKMEAIPGWRADLSNDEMMRQLEEVGAVICAAGPGLAPADKKLYALRDVTGTVES
IPLIASSIMSKKIAEGTSALVLDVKTGTGAFMKTEADSRELARRLVDLGRAAGVTTSALL
TRMDAPLGRAAGNGVEVAEAIEVLEGGGPADVVALTLALARRMVESVGLDADPEQVLRSG
RAMDVWRQMVRAQGGDPDARLPVARHSQDVVATADGTLTGIDAMDVGLAAWRLGAGRARK
EDPVQAAAGVYLTAQIGDEVVAGQPLATLLTDTAEAIPRAEEALAGAFRIGAPEPPADLV
IDVL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccaattcgatgtggtggacctcatcaggtccaagaggtccggtctcagactc
gacgacgagcagatcgactggcttctggacgcctacaccagcgggttcgtggccgacgag
cagatgtcggccatggcgatggcgatcttcttccaggggctcgaccaccgggagctgtcg
cgctggacggcggcgatgatcgcctccggggagcgcctcgacttctccggcctgtcgcgg
ccgaccgtcgacaagcactcgaccggcggagtgggcgacaagatcacccttcccctggct
cctctggtggccgcctgcggggcggcggtgccccagctgtcggggagggggctcggccac
accggcggcaccctggacaagatggaggccatccccggctggcgcgccgacctgtccaac
gacgagatgatgcgccagctcgaggaggtgggggcggtgatctgcgcggcggggcccggg
ctggccccggccgacaagaagctctacgccctgcgcgacgtcaccggaaccgtcgagtcg
atcccgctgatcgcctcctccatcatgagcaagaagatcgccgagggcacctcggccctg
gtcctggacgtcaagacgggaacgggcgccttcatgaagaccgaggccgactcccgcgag
ctggcccggcggctggtcgatctcggccgggcggccggggtgacgacgtcggccctgctc
accaggatggacgcccccctcggtcgggcggcgggaaacggcgtggaggtggccgaggcg
atcgaggtgctcgagggcggtggccccgccgacgtggtcgccctcaccctggccctggcg
cggaggatggtcgaatccgtcgggctggacgccgaccccgagcaggtgctgcgttcgggc
cgcgcgatggacgtgtggcgccagatggtgcgcgctcagggcggcgaccccgatgcccgg
ctgccggtggcccggcactcccaggacgtggtggccaccgcggacgggacactcaccggt
atcgacgccatggacgtcgggctggccgcctggcgcctgggagcggggcgggcccgcaag
gaggacccggtccaggccgccgccggggtgtacctcaccgcccagatcggcgacgaggtg
gtggcgggccagccgctggcgaccctgctcaccgacaccgccgaggcgatcccccgggcc
gaggaggcgctggccggggcgttcaggatcggcgccccagagcctccggccgacctggtg
atcgacgtcctgtga

DBGET integrated database retrieval system