KEGG   Propionibacterium acidipropionici: PACID_23510Help
Entry
PACID_23510       CDS       T02345                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pbo  Propionibacterium acidipropionici
Brite
Enzymes [BR:pbo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PACID_23510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2490995..2491567
Genome map
AA seq 190 aa AA seqDB search
MGDDRIDEAFRAVPRSAFLPMTLRRLVGVDDALPLGGGPTCSQPSTVRDMLILLDVRPGD
RVLDVGSGSGWTTGLLSRLAAPGEVIGVELESRLVKSSRRALARIPDLSPWRIEVPEPGV
LGLPSDGPYDRILISADARGRAPEPLLEQLADGGVLVGPVGGVMTRVTRSGDHLRTTHHG
QYVFVPLQEP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgaccggatcgatgaggccttccgggcggtgccgcgatcggcgtttctgccg
atgacgctgcgacgcctggtgggagtcgacgacgccctgccgctgggcggcggccccacc
tgctcccagccctccacggtgcgcgacatgctcatcctgctcgacgtgcgccccggcgac
cgggtcctggacgtcggctccggttcgggctggacgacggggctgctctcacggctggcg
gcccccggcgaggtgatcggggtcgaactcgaatcgcgtctggtgaagtcatcgcgcagg
gcgctggcccggatccccgacctgagcccctggcgcatcgaggtccccgaaccaggagtc
ctcggcctgccctcggacggcccctacgaccggatcctgatctcggccgacgcccgcggt
cgggcccccgagccgctgctggaacagctcgccgacggcggtgtcctggtgggcccggtg
ggcggcgtcatgacccgggtcactcgttccggggatcacctgagaaccacgcatcacggg
cagtacgtcttcgtgcccctccaggagccctga

DBGET integrated database retrieval system