KEGG   Propionibacterium acidipropionici: PACID_23940Help
Entry
PACID_23940       CDS       T02345                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PACID_23940
Enzymes [BR:pbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PACID_23940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2530412..2532529)
Genome map
AA seq 705 aa AA seqDB search
MPLTDPALVALAEHFGVARSFTDWKGRQTFVDDETIRAVLGGLGIDAGTPEKAEEALVAV
EERPWRRTLPPCTVLRQGQEGRIDVHLPAGQQVEVSIELEDGRSRSCWQVDNWNPDRQID
GRQVGEATFGIPSDLPLGYHTVVAGTVDRRSTASLIVTPSWVGLPAAMESRRVWGYATQI
YSVRSHNSWGMGDLTDLADLCTWSATQGADYLLINPLHAAEVVPPMEPSPYLPSSRLFLN
PVYVRPELIPEYQDLDDAARDHARALRVEAVGNDTAAERIDRDRTWTRKRPVLEEIHRTG
LGPARRMAFRAFRRLRGSRLSDFAAWCAISEVHGSNWKLWPEPLQHPGSREVAAFVASHA
SRVDFYEWLQWIAEQQLSAADRAGRDSGMALGLICDLAVGVSGCGADTWMLPNLFAEGVS
VGSPPDQFNQAGQDWGQPPMRPDVLAEMAYRPFREMVAGALRHAGGLRMDHIMGLFRLWW
VPLGLGPRKGAYVRYDHEAMVGILALEAYRAGALVIGEDLGTVEPWVRDYLRDRGLFGTS
VMWFELDGAGRPLAPEQWREYALSSVTTHDLPPTIGYLAGDHVELRHRLGLLTESVDSER
AQAVAEREQWVQELRNRGALASACPTDEEIVVAMHRLLTWTPSRILNATLTDAVGDRRTQ
NLPGTVNEYPNWRVPLSGPDGRPMWLEDLYVDQRAARIADVLNGN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgactgaccccgccctcgtcgccctggccgaacacttcggcgtggcccgcagc
ttcaccgactggaagggccgacagaccttcgtcgacgacgagaccatcagggcggtgctc
ggcgggctcgggatcgacgccggcaccccggagaaggccgaggaggcgctggtggccgtc
gaggagcggccgtggcgccgcaccctgccgccatgcacggtgctccggcagggccaggag
ggccggatcgacgtccacctgccggcgggccagcaggtggaggtctccatcgaactggag
gacggcaggtcccggtcctgctggcaggtcgacaactggaatcccgatcgccagatcgac
ggaaggcaggtcggcgaggccaccttcggcatcccctccgatctgccgctgggctaccac
acggtggtcgccggcaccgtcgaccgtcgcagcaccgccagcctcatcgtgaccccgagc
tgggtcgggctgccggccgcgatggaatctcgaagggtctggggctacgccacgcagatc
tactcggtgcggtcgcacaattcgtgggggatgggggatctcaccgatctggccgacctg
tgcacctggtcggccacccagggcgccgactacctgctcatcaatccgctgcacgccgcc
gaggtcgtccctccgatggagccctcgccatacctgccgtcgagccggctcttcctcaat
cccgtctacgtgcgtccggagctgatccccgagtaccaggacctcgacgacgccgcccgc
gatcacgcccgtgcgctgcgggtggaggccgtcggcaatgacaccgccgcggagcggatc
gatcgggaccgcacctggacgcgcaagaggccggtgctggaggagatccaccggacgggg
ctggggccggcccgcaggatggcgttccgggcgttccggcggttgcgcggctcccggctg
tccgacttcgcggcctggtgcgcgatctcggaggtgcacggatccaactggaagctgtgg
cccgagccgctccagcatccggggagccgggaggtcgccgccttcgtcgcctcgcacgcg
agccgggtggatttctacgagtggctgcagtggatcgccgagcagcagctgtcggcggcc
gaccgggccgggcgggactccggcatggcgctgggcctcatctgcgatctggcggtcggg
gtcagcggctgcggcgccgacacctggatgctgcccaacctcttcgccgagggggtgagc
gtcggctcgccgcccgaccagttcaaccaggccggtcaggactggggacagcccccgatg
cgccccgacgtgctggccgagatggcctaccggcccttccgggagatggtcgccggggcg
ctgaggcacgccggcgggctgcggatggaccacatcatggggctcttccggctctggtgg
gtccccctggggctgggaccccgcaagggcgcctatgtccgctacgaccatgaggcgatg
gtcgggatcctcgcactggaggcctaccgcgccggagccctggtgatcggcgaggatctc
gggacggtcgagccgtgggtgcgcgactacctgcgcgaccgcggccttttcggcacatcg
gtgatgtggttcgagctggacggcgccggccgaccgctggcgccggagcagtggcgggag
tacgccctgtcctcggtgaccacccacgatctgccgcccaccatcggctatctggccggc
gaccacgtcgagctgcgtcaccggctggggctgctcactgagagtgtggactccgagcgg
gcgcaggcggtggccgagcgcgagcagtgggtgcaggagctgcggaatcgcggtgcgctg
gcgtcggcgtgtcccaccgatgaggagatcgtggtggcgatgcaccggctgctcacctgg
accccgtcgcggatcctcaacgccaccctcaccgatgcggtgggggaccgacgcacccag
aaccttcccggcaccgtcaacgagtacccgaactggcgggtgccgctgtcgggccccgac
gggcgtccgatgtggctggaggacctctatgtcgaccagcgggcggcgcggatcgccgac
gtcctcaacggcaactga

DBGET integrated database retrieval system