KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_24710Help
Entry
PACID_24710       CDS       T02345                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00020  Citrate cycle (TCA cycle)
pbo00640  Propanoate metabolism
pbo00660  C5-Branched dibasic acid metabolism
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01120  Microbial metabolism in diverse environments
pbo01130  Biosynthesis of antibiotics
pbo01200  Carbon metabolism
Module
pbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PACID_24710 (sucC)
   00640 Propanoate metabolism
    PACID_24710 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PACID_24710 (sucC)
Enzymes [BR:pbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PACID_24710 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFV90247
UniProt: K7S6J9
Position
complement(2611744..2612919)
Genome map
AA seq 391 aa AA seqDB search
MDLYEYQARDLFEKHGVPVLRGIVAQTPQEAAAAAAELATPVVAVKAQVKVGGRGKAGGV
KIARSPQEAADHASAILGMDIKGHTVGKVMIAEGAEIAEEYYFSILLDRGERRYLAMCSR
EGGMDIETLAAERPEALARVPVDPIDGIDEAKAHEILTEAGFPEADQPAIVPVLLRLWDV
YTGEDATLVEVNPMVRTADGSIIALDGKVTLDGNAAFRHPEHSDLIDRATTDPLELRAGE
LGLNYVKLDGIVGVIGNGAGLVMSTLDVVAYAGEEFPGSPKPANFLDIGGGASAEIMANG
LDLIMSDPQVKSVFVNVFGGITACDAVANGIKSALESLGDRATKPLVVRLDGNAVEQGRA
ILNDFNHPLVTMAATMDEAASKAAELASREA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgagtaccaagcccgcgacctgttcgagaagcacggcgtccccgtgctc
cgcggcatcgtcgcccagaccccccaggaggcggccgcagcggcggccgagctcgccacc
ccggtcgtggccgtcaaggcccaggtcaaggtgggcggccgcggcaaagccggcggcgtc
aagatcgcccggtcgccccaggaggcggccgatcacgcctcggcgattctcgggatggac
atcaagggccacacggtcggcaaggtgatgatcgccgagggggccgagatcgccgaggag
tactacttctcaatcctgctcgaccgtggggagcggcgctatctggcgatgtgctcccgc
gagggcgggatggacatcgagaccctcgccgccgagaggcccgaggccctggcccgggtg
cccgttgaccccatcgacggcatcgacgaggcgaaggcccatgagatcctcaccgaggcg
ggcttccccgaggccgatcagccggccatcgtgccggtcctcctgcggctctgggacgtc
tacaccggtgaggacgccaccctcgtcgaggtcaaccccatggtgaggaccgcggacggt
tcgatcatcgccctggacggcaaggtgaccctggacggcaatgccgccttccgtcacccc
gagcactccgacctcatcgaccgcgccaccactgacccgctggagctgcgggccggcgag
ctggggctcaactacgtcaagctcgacggcatcgtcggcgtcatcggcaacggcgccgga
ctcgtgatgagtaccctcgacgtcgtcgcctacgccggggaggagttccccggatcgccc
aagcccgcgaacttcctcgacatcggcggcggcgcctcggccgagatcatggccaacggc
ctggacctcatcatgtccgacccccaggtgaagtcggtcttcgtcaatgtgttcgggggc
atcaccgcctgcgatgcggtggccaacggcatcaagtccgcactggagagcctcggcgac
cgggccaccaagccgctggtggtgaggctggacggcaatgccgtcgaacagggccgcgcg
atcctcaacgacttcaaccatccgctcgtgaccatggccgccaccatggacgaggccgcc
agcaaggccgccgagctcgcttccagggaggcctga

DBGET integrated database retrieval system