KEGG   Propionibacterium acidipropionici: PACID_26100Help
Entry
PACID_26100       CDS       T02345                                 

Definition
enoyl-CoA hydratase/isomerase family protein (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PACID_26100
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PACID_26100
   00650 Butanoate metabolism
    PACID_26100
  Lipid metabolism
   00071 Fatty acid degradation
    PACID_26100
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PACID_26100
   00310 Lysine degradation
    PACID_26100
   00360 Phenylalanine metabolism
    PACID_26100
   00380 Tryptophan metabolism
    PACID_26100
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PACID_26100
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PACID_26100
   00281 Geraniol degradation
    PACID_26100
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PACID_26100
   00627 Aminobenzoate degradation
    PACID_26100
   00930 Caprolactam degradation
    PACID_26100
Enzymes [BR:pbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PACID_26100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2743505..2744461)
Genome map
AA seq 318 aa AA seqDB search
MQDQPEQNSDLEIVRSGEELQIRLQRPRAINSLTGAMLGDIGRAVPGSTRLDISGAGEKG
FCSGADIRELRSLALSDVEAATGWLETEYDVDLAIARLGHGVAHLHGVSMGGGLGLTLRL
ERVEAARDLVLAMPETGIGLWPDVGACWELSRAPRLAGRHLAMTGMSIDAASALWAGLVD
VVVDEEGSPLDVDPLESELAADAGWIQECYRFNDPVSILEALASRPEPEARAAADLISTR
SSLSVAVALEAVQRAEQASGVEEVLATDRVLGRSFMRASDFCEGVRAQLVDKDHDPHWSH
ASVADVSRAEVEAMFDAQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggatcagccagagcagaactccgatctggagatcgtgaggtccggtgaggagctg
cagatccggctccagcggccccgggcgatcaactcactcaccggggcgatgctcggcgat
atcgggcgcgccgtgcccggcagcacccggttggacatctcgggtgcgggggagaagggg
ttctgctcgggggccgacatccgcgaactgcggagcctggccctgagcgacgtcgaggca
gccaccggatggctcgagaccgagtacgacgtcgacctggcgatcgcccgactgggtcac
ggggtggcccatctgcacggggtgagcatgggcggcggtctgggattgacgctacggctc
gagcgcgtggaggcggcccgggatctcgtgctggcgatgccggagaccgggatcgggctg
tggcccgacgtcggggcgtgctgggaactctcccgcgctccgcgtctggcgggccgccat
ctcgcgatgaccgggatgtcgatcgacgccgcctcggccctgtgggccgggctcgtcgac
gtcgtcgtcgatgaggaggggagccctctcgacgtcgacccgctggagtccgagctggcc
gcggatgcgggctggatccaggagtgctaccggttcaacgacccggtgagcatcctggag
gccctggcgtcacggcccgaacccgaggcgcgggccgcggccgatctcatctccacgcgg
tcgtcgctgtcggtcgcggtggcgctggaggccgtccagcgcgccgagcaggcctccggt
gtcgaggaggtcctggccaccgaccgggtgctcggccggtccttcatgagggcctccgac
ttctgcgagggggtcagggcgcagctggtggacaaggatcatgatccccactggagccac
gcctcggtggccgatgtcagccgtgccgaggtcgaggcgatgttcgacgcgcagtga

DBGET integrated database retrieval system