KEGG   Propionibacterium acidipropionici: PACID_27990Help
Entry
PACID_27990       CDS       T02345                                 

Definition
(RefSeq) uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
  KO
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PACID_27990
Enzymes [BR:pbo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PACID_27990
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PACID_27990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2948759..2950324)
Genome map
AA seq 521 aa AA seqDB search
MQFIGTGPGDPGLLTLSAGRAIGRAQRIVVDSPDQKALLDADEVGLAVGAEVIEAASQIE
VIEALIDAARQGLDVVRLVPGDPFLDGDVASEAAALAVADYDVDVIPGVSPMTAIPEYAG
VTLNGHDAQIIGPDACRRDLGGKGRSWAATGLVVVATTAGQVDRVVRHAIDSGRDQTEPA
VITRNGGTTQQVSTTTTLEALPAAVARAGEEEPVHIVIGHVLNDPEDDRLDWFESKPLFG
WNVLIPRTRDHSATLPSRLQGYGAHSLDVPTISMEPPRTPQQMDKAIRGLVEGRYEWVVF
TSANAVRAVREKLEGLGLDSRAYSGLRIAAIFDSTIKTLAEWGVKPDLVPSGEQSTAALA
AVFPAFDDALDPINRVFVPRADIATESLSADLSALGWDVEDVIGYRTVRAAPPPADTREA
IKTGAFDAVVFTSSTTVRNLVGIAGKPHRHTVVAAIGPRTAETCEEHGLQVDVIAPEPEA
ISLADALADFAARRRDELLASGRPVVRPSQRKRRGRQPSSR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttcatcgggaccggtccgggtgatccgggactgctcaccctctcggccggcaga
gccatcggccgggctcagcgaatcgtggtggactcccccgaccagaaggccctgctggac
gccgacgaggtgggcctggctgtcggggccgaggtcatcgaggccgcctctcagatcgag
gtcatcgaggccctcatcgacgccgcccgacaggggctggacgtcgtccggctcgtcccc
ggggatcccttcctcgacggggacgtggcctccgaggccgccgccctggccgtcgccgac
tacgacgtcgacgtcattcccggggtctccccgatgaccgccatccccgagtacgccggg
gtgaccctcaatggtcatgatgcccagatcatcgggcccgacgcgtgccgccgcgatctg
ggcggcaagggccgctcgtgggcggccaccggtctcgtcgtggtcgccaccaccgcgggg
caggtggacagggtggtgcgtcacgccatcgattcgggacgcgaccagaccgagccggcc
gtcatcacccgcaacggcggtaccacccagcaggtgtccaccaccacgaccctggaggcg
ctgcccgcggcggtggccagggcgggggaggaggagccggtgcacatcgtcatcggccat
gtgctcaacgaccccgaggacgaccgactcgactggttcgagtccaagccgttgttcggc
tggaatgtgctcatcccgcggacccgcgaccactcggccacgctgccgtcccggctgcag
ggatacggggcccacagcctcgacgtgcccaccatctcgatggagccgccgcgcaccccc
cagcagatggacaaggcgatccgcggcctggtcgagggtcgatacgagtgggtcgtgttc
acctccgcgaacgctgtgcgggcggtccgcgagaagctcgaggggctgggcctggactcc
cgcgcctattcggggctgcggatcgcggcgatcttcgactccaccatcaagaccttggcg
gagtggggcgtcaagcccgatctggtgccctccggggagcagtccaccgcggccctggcg
gccgtcttcccggccttcgacgacgctctggacccgatcaaccgggtcttcgtgccgcgc
gccgatatcgccaccgagtccctgtcggcggatctttcggcgctgggctgggacgtcgag
gacgtcatcggctatcgcaccgtccgggccgccccgccgcctgccgacacccgggaggcg
atcaagaccggtgccttcgatgcggtggtcttcacctcctcgacgacggtgcgcaatctg
gtcggcatcgccggcaagccacaccggcacaccgtggtggccgcgatcggtccgcgcacc
gcggagacctgcgaggagcacggcctgcaggtcgacgtcattgctcccgagccggaggcg
atcagcctcgccgacgccctggccgacttcgcggcccgccgtcgcgacgagttgctggcc
agtggacggccggtggtgcggccctcccagcgcaagcggcgagggcggcagccctcctcc
cggtga

DBGET integrated database retrieval system