KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_28190Help
Entry
PACID_28190       CDS       T02345                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00860  Porphyrin and chlorophyll metabolism
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PACID_28190
Enzymes [BR:pbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PACID_28190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFV90586
UniProt: K7RVY1
Position
2970506..2971333
Genome map
AA seq 275 aa AA seqDB search
MTAGPSGIIRPPVLVPRQGAHDRIGAALKHAGFGVIHQPVTRTVEIDGGLGTVGSHLSAL
GTHPSTVGSHPSTVGALGTVGFRSSTAQPDWLVVTSHTAVRILQEAGLLDGLALKVAAVG
RATARALKDAGVDVDLVPQQQSGAGLVDAWADPGARVLLPVSALAAPTVGDGLREQGCDV
TRVDLYTTEPLDELPEVIAQAWPAFGAVVVTSSSVARALDSLVSAAGLSWTARQHPVAMG
RPTADTLSELGHPAAAVAAAPTPEAILTAVESVIS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccggcccgtccgggatcatccgcccgcccgtcctggtgccccgtcagggcgcc
catgacagaatcggcgcggccctcaagcacgccggattcggcgtcatccaccagcccgtc
acccgcaccgtcgagatcgacggcggcctcggcaccgtcggctcccacctcagcgctctc
ggcacccaccccagtaccgtcggctcccaccccagtaccgtcggcgccctcggcaccgtc
ggcttccgcagcagcaccgcccagccggactggttggtggtcaccagccacaccgccgtc
cggatcttgcaggaggccgggctgctggacgggctggccctgaaggtcgccgctgtgggc
cgggccaccgcccgggccctcaaagacgccggcgtcgacgtcgacctggtgccccagcag
cagtccggggccgggctggtggacgcctgggccgatcccggcgcccgcgtgctgctgccc
gtctccgcgctcgccgcgccgaccgtcggtgatggtctgcgcgaacagggctgcgacgtc
acccgcgtcgacctgtacaccaccgagcccctcgatgagctgcccgaggtgatcgcccag
gcctggccggccttcggggccgtcgtcgtcacctcatcgtcggtggcccgtgccctggac
tccctggtgagcgccgccgggctgtcctggaccgcccgccagcaccccgtcgcgatgggc
cggcccaccgccgacaccctgtccgaactcgggcatccggccgcggccgtcgccgccgcc
cccacccccgaggccatcctcaccgccgtagaaagtgtcatctcatga

DBGET integrated database retrieval system