KEGG   Propionibacterium acidipropionici: PACID_28450Help
Entry
PACID_28450       CDS       T02345                                 

Gene name
folK
Definition
hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pbo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3000137..3000700)
Genome map
AA seq 187 aa AA seqDB search
MSLPKDTVAPGIHVETLGAMRPLRTVVFSLGANLGDTLETLQGAVDQLCDTPNAIPVGVS
PVYLTKPVGKLDQPDFHNLVLVMESTLTARTLLERALAIEDAFGRERLEVNGPRTVDVDL
IQVGPLSIDEADLKIPHPRAHERAFVLVPWHDVEPGAVLEGHGPISELIAGLDTSGVRSV
GPEVTLS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcccaaagacaccgtcgccccggggatccatgtcgagaccctcggtgcgatg
aggccgctgcgcactgtcgtgttcagcctcggcgcaaatctcggcgacaccctggagacc
ctccagggtgctgtcgatcagttgtgcgacaccccgaatgccattccggtgggggtctcc
ccggtgtatctcaccaagccggtcggcaagctggaccagccggatttccacaacctggtg
ctggtgatggagtcgacgctgaccgcccggacgctgctcgagcgcgctctggcgatagag
gatgccttcggccgggagaggctggaggtcaacggtcctcgcaccgtcgacgtcgacctc
atccaggtggggccgttgagcatcgacgaggcggatctcaagattccgcatccgcgtgcc
catgagcgggccttcgtgctggttccgtggcacgacgtcgagcccggtgcggtgctggag
ggccacggcccgatctccgagttgatcgccgggctcgacacctccggggtgcggtcggtg
ggtccggaggtcacgctgtcgtga

DBGET integrated database retrieval system