KEGG   Propionibacterium acidipropionici: PACID_30180Help
Entry
PACID_30180       CDS       T02345                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PACID_30180
Enzymes [BR:pbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PACID_30180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3185376..3186371
Genome map
AA seq 331 aa AA seqDB search
MPDPFTVPEVSRAGLCVVGSFMMDLIAYAERQPRPGETLIGYDFVQAPGGKGFNQALAAA
RAGAPTSMLGRLGTDSFGDEFLAALGAEGIDCSGVIRDEKTGTGVGHPTVARDGQNAIVV
VPRSNSSLTPDDIREHRCAITSAGVMLLQLELPMPAVLEAARIAHEAGTLVILNPAPFSP
LPDELLDLCDVIVPNEVELAQWAGRRPADDGQVAELAQNLADDHGLTVIVTIGDRGSLIC
APMSPITRVGAHHVTAVDTVGAGDTFCGHLAALLSMGSALPRAIGRASAAAAITVTRRGG
NASPTTAETDDFLAKAGQGPTPLLTTARTSS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacccgttcacggtcccggaagtctccagggccggcctgtgcgtcgtcgggtcc
ttcatgatggatctcatcgcctacgccgagcgccagccccggccgggcgagaccctcatc
ggctacgacttcgtgcaggcccccggcggcaagggattcaaccaggccttggcggcggca
cgggcaggcgctccgacgtcgatgctcggccgcctgggcaccgattccttcggcgacgag
ttcctggcggcgctgggggccgagggcatcgactgcagcggcgtcatccgcgatgagaag
accgggaccggggtcggtcatccgaccgtcgctcgtgacgggcagaatgcgatcgtcgtc
gtcccgcgctccaacagctcactgactcccgacgacatccgggagcatcgctgtgccatc
acctcagcaggcgtcatgcttcttcagctcgagcttccgatgcctgctgtcctggaagct
gcccgtatcgcgcacgaggccggtaccctcgtcatcctcaaccctgccccgttcagccct
ctgcccgacgagctcctagacctgtgtgacgtcatcgtcccgaacgaggtggaactcgcc
caatgggccggccgacgccccgcagacgacggtcaggtcgccgaactggcccagaacctg
gccgacgaccacggtctgacggtcattgtcaccatcggtgaccgcggctccctcatctgt
gccccgatgtccccgatcacgcgcgtcggggcgcaccacgtcacggctgtggacaccgtg
ggtgccggggacaccttctgcggtcacctggccgctctgctgtccatgggctcggcgctg
ccccgcgccattggccgagcaagcgccgcagccgccatcaccgtcacccgaaggggaggc
aatgcctcaccgaccaccgcagagaccgacgacttcctggccaaggccggtcagggaccc
acacctctcctcaccacagcaaggacctcctcatga

DBGET integrated database retrieval system