KEGG   Propionibacterium acidipropionici: PACID_30710Help
Entry
PACID_30710       CDS       T02345                                 

Definition
Family 13 glycosyl hydrolase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pbo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3236711..3238633
Genome map
AA seq 640 aa AA seqDB search
MSSSAHQNPTPETGDASATRTPTAPEDPATRARGMGAVLIDGGVGFRVWAPHATGVDVTG
DFDDWNALPSGEPQDAKTDAPEPATAEHTLLGEGNGFWYGEVAGAHVGQQYRFVIHAADG
RLISRIDPYARQVTSSVGNGVITDPEAFDWQGDSFTPPTLNELVIYEMHVGTFFDADPSD
DRPATLDAVEQKMSHLVHLGVNAVELMPMAEFAGDYSWGYNPANIFAVESTYGGPEKLRE
FVRIAHSHGIAVIIDVVYNHFGPSDLDLWQFDGWSENDKGGIYFYNDWRSATPWGDTRPD
YGRGEVRQFIHDNAMMWLGEFHADGLRYDMTPYMRSVDAGEMNIPDGWSLSRWINSDIRA
TYPERFTIAEDLHGYGAVTSTGEDGAAFHAQWDNHFVHPIRAAVIAADDASRDMGQVRDA
VEFSYGDAFSRVIYTESHDEVANGSARVPEEIDAGDPDGYFAQKRSTLGAALVFTSPGVP
MIFQGQEFLTDGWFRDSVPLDWHMNREFHGIVRLYAGLIDLRLNVDGTTAGLTGQYAQTL
HLHDDNNVYAFHRWSEGGPGDDVVVAANFNNSMYGEYTIPMPAAGGWTTRVNTDARVYSD
LFTGAVVPAHVEAAAEPLDGFAARATLVLPPYAAVILSRD
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcagcgcccaccagaacccgactcctgagaccggggatgcgtcggcgacccgg
acccccaccgcacccgaggatcccgccacccgcgccagagggatgggtgccgtcctcatc
gacgggggcgtcggcttccgggtgtgggcgccgcacgccaccggggtcgacgtcaccgga
gatttcgacgactggaacgccctgcccagcggggagccccaggatgcgaagaccgacgcc
ccggagcccgcgaccgccgagcacaccctgctgggcgaggggaacgggttctggtacggc
gaggtcgccggggcccacgtgggccagcagtaccgcttcgtgatccacgccgccgacggc
cgcctcatctcccgcatcgacccctacgcccgtcaggtcaccagctcggtcggcaacggc
gtcatcaccgacccggaggccttcgactggcagggcgactccttcaccccgccgaccctc
aacgagctggtcatctacgagatgcacgtcggcactttcttcgacgccgacccctccgac
gaccggcccgccaccctcgacgccgtcgagcagaagatgagccacctggtccacctgggg
gtcaacgccgtcgagctgatgcccatggccgagttcgccggcgactactcctggggttac
aacccggccaacatcttcgcggtggagagcacctacggcggccccgagaagctgcgcgag
ttcgtgaggatcgcccattcccacggcatcgccgtcatcatcgacgtcgtctacaaccac
ttcggcccctccgacctggacctgtggcagttcgacgggtggagcgagaacgacaagggc
ggcatctacttctacaacgactggcgctcggccaccccctggggggacacccgccccgac
tacggccgcggcgaggtgcgccagttcatccacgacaacgcgatgatgtggctcggcgag
ttccacgccgacggcctgcgctacgacatgacgccgtacatgcgcagcgtcgacgccggc
gagatgaacatccccgacggatggtccctgtcccgctggatcaactccgacatccgcgcc
acctaccccgaacggttcaccatcgccgaggacctccacggctacggtgcggtgacctcg
acgggcgaggacggagcggccttccacgcccagtgggacaaccacttcgtccacccgatc
cgcgccgcggtgatcgccgccgacgacgcctcgcgggacatggggcaggtgcgcgacgct
gtcgagttcagctacggcgacgccttttcccgggtgatctacaccgagtcccatgacgag
gtggccaacggctcggcgcgggtccccgaggagatcgacgccggggacccggacggctat
ttcgcccagaagcgctcgaccctgggagcggcgctggtgttcacctcccccggcgtcccg
atgatcttccagggccaggagttcctcaccgacggatggttccgcgactcggtgccgctg
gactggcatatgaatcgcgagttccacgggatcgtgaggctctacgccggcctcatcgac
ctgcgtctcaacgtcgacggcaccaccgccggcctcaccggccagtacgcccagaccctc
cacctccacgacgacaacaacgtctacgccttccaccggtggtccgagggagggccggga
gacgacgtcgtggtggcggccaacttcaacaactcgatgtacggggagtacacgatcccg
atgcccgccgccggtggatggaccacccgggtcaacaccgacgcgcgcgtctactcggac
ctgttcaccggggcggtggtgccggcccacgtcgaggccgcagccgagcccctcgacggc
tttgcggcccgggcaaccctggtgctgccgccctacgccgccgtgatcctgtcgcgggac
tga

DBGET integrated database retrieval system