KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_31100Help
Entry
PACID_31100       CDS       T02345                                 

Definition
(GenBank) Biotin-requiring enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00010  Glycolysis / Gluconeogenesis
pbo00020  Citrate cycle (TCA cycle)
pbo00620  Pyruvate metabolism
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01120  Microbial metabolism in diverse environments
pbo01130  Biosynthesis of antibiotics
pbo01200  Carbon metabolism
Module
pbo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PACID_31100
   00020 Citrate cycle (TCA cycle)
    PACID_31100
   00620 Pyruvate metabolism
    PACID_31100
Enzymes [BR:pbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PACID_31100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFV90870
UniProt: K7SNW3
Position
complement(3281981..3283468)
Genome map
AA seq 495 aa AA seqDB search
MKYYRMPDPGEGLTEAEVVSWRVAEGDTVEVNDVLCEVETAKSIVELPSPFAGTVAKIRA
AEGDTVPVGGPLVAIDEGGDDEPEPELLVGHISAEKGGRRRRRRGAGASAPEPGSAPAAD
SVPAAPSTPAPTPAAQESPVQAPQRSCEKTCEAPAAPEPEQPEPVAPEPPRADVTEGPEH
VLAKPPARRLAKDLGIDLASVNGTGPGGVVTRTDVKQAATGRDAAPAPSAPVADDVPQSW
RSISPASRKLLDGDPTDASGAERRVRIQGVRKVTAQAMKESIDTKALVTSFITCDVSRSM
ELVDKLRKDRKFKGLRVSPLTLWCRAACLAMTRTPVINARWDDESGEIVYNRDINLGIAA
ATPRGLMVPVLRGAQDMNLLELAQELTRIIAIAKEDRLTPSDYSGGTFSISNVGVFGLDA
GTPVVNRTESALLVLGTIARRPWVIGEGAEEKIVPRWVTTMSLGFDHRLVDGEQGSIFLH
DVAEILSEPDTALLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtattaccgcatgcccgatccgggcgagggactcaccgaggccgaggtggtgtcc
tggcgggtggccgagggcgacaccgtcgaggtcaacgacgtcctgtgcgaggtggagacc
gccaagtcgatcgtcgagctgccgagccccttcgccggcaccgtcgccaagatccgcgcc
gccgagggcgacaccgtcccggtcggcgggccgctggtggccatcgacgagggcggcgac
gatgagcccgaacccgagctgctggtcggccatatctcggccgagaagggtggacgacgc
cgtcgccgccgcggcgcaggggcctcggcccccgagccaggatcggctcccgcggccgac
tcggtccccgcggccccgtcgaccccggcgcccacccccgcggcgcaggagagccccgtc
caggccccgcagcgatcctgcgagaagacctgcgaagctcccgccgcccccgagcccgag
cagcccgagcccgtcgccccggagcccccgcgcgccgacgtcaccgagggccccgagcac
gttctggccaagcccccggcccggcgcctcgccaaggacctgggcatcgacctcgcctcg
gtcaacggcaccggccccggaggagtcgtcacccgcaccgacgtcaagcaggccgccacc
ggccgcgacgccgctcccgcacccagcgcgccggtggccgacgacgtgccgcagtcctgg
cggtcgatctccccggcctcgcgcaagctgctcgacggcgaccccaccgacgcgtcgggg
gccgagcgcagggttcgcatccagggcgtccgcaaggtcaccgcccaggccatgaaggag
tccatcgacaccaaggcgctggtcaccagcttcatcacctgcgacgtcagccgcagcatg
gagctcgtcgacaagctccgcaaggaccgcaagttcaagggcctgcgcgtctccccgctc
accctgtggtgccgggccgcctgcctggcgatgacccgcacccccgtcatcaacgcccgg
tgggatgacgagtccggcgagatcgtctacaaccgcgacatcaacctcggtatcgccgcc
gccaccccgcgcggcctcatggtgccggtgctgcgcggggcccaggacatgaacctcctc
gagctcgcccaggagctcacccgcatcatcgccatcgccaaggaagaccggctcaccccg
tccgactactccggcggcaccttctcgatctccaatgtcggggtcttcggactggacgcc
ggcacccccgtcgtcaaccggaccgaatcggcgctgctggtgctcggcaccatcgcccgc
cggccctgggtgatcggcgagggggccgaggagaagatcgtgccccgctgggtcaccacc
atgagcctcggattcgaccaccgcctggtcgacggggagcagggttcgatcttcctccac
gacgtcgccgagatcctctcggagccggacacggcgctgctgtactag

DBGET integrated database retrieval system