KEGG   Propionibacterium acidipropionici: PACID_31100Help
Entry
PACID_31100       CDS       T02345                                 

Definition
biotin-requiring protein (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PACID_31100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PACID_31100
   00020 Citrate cycle (TCA cycle)
    PACID_31100
   00620 Pyruvate metabolism
    PACID_31100
Enzymes [BR:pbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PACID_31100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3281981..3283468)
Genome map
AA seq 495 aa AA seqDB search
MKYYRMPDPGEGLTEAEVVSWRVAEGDTVEVNDVLCEVETAKSIVELPSPFAGTVAKIRA
AEGDTVPVGGPLVAIDEGGDDEPEPELLVGHISAEKGGRRRRRRGAGASAPEPGSAPAAD
SVPAAPSTPAPTPAAQESPVQAPQRSCEKTCEAPAAPEPEQPEPVAPEPPRADVTEGPEH
VLAKPPARRLAKDLGIDLASVNGTGPGGVVTRTDVKQAATGRDAAPAPSAPVADDVPQSW
RSISPASRKLLDGDPTDASGAERRVRIQGVRKVTAQAMKESIDTKALVTSFITCDVSRSM
ELVDKLRKDRKFKGLRVSPLTLWCRAACLAMTRTPVINARWDDESGEIVYNRDINLGIAA
ATPRGLMVPVLRGAQDMNLLELAQELTRIIAIAKEDRLTPSDYSGGTFSISNVGVFGLDA
GTPVVNRTESALLVLGTIARRPWVIGEGAEEKIVPRWVTTMSLGFDHRLVDGEQGSIFLH
DVAEILSEPDTALLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtattaccgcatgcccgatccgggcgagggactcaccgaggccgaggtggtgtcc
tggcgggtggccgagggcgacaccgtcgaggtcaacgacgtcctgtgcgaggtggagacc
gccaagtcgatcgtcgagctgccgagccccttcgccggcaccgtcgccaagatccgcgcc
gccgagggcgacaccgtcccggtcggcgggccgctggtggccatcgacgagggcggcgac
gatgagcccgaacccgagctgctggtcggccatatctcggccgagaagggtggacgacgc
cgtcgccgccgcggcgcaggggcctcggcccccgagccaggatcggctcccgcggccgac
tcggtccccgcggccccgtcgaccccggcgcccacccccgcggcgcaggagagccccgtc
caggccccgcagcgatcctgcgagaagacctgcgaagctcccgccgcccccgagcccgag
cagcccgagcccgtcgccccggagcccccgcgcgccgacgtcaccgagggccccgagcac
gttctggccaagcccccggcccggcgcctcgccaaggacctgggcatcgacctcgcctcg
gtcaacggcaccggccccggaggagtcgtcacccgcaccgacgtcaagcaggccgccacc
ggccgcgacgccgctcccgcacccagcgcgccggtggccgacgacgtgccgcagtcctgg
cggtcgatctccccggcctcgcgcaagctgctcgacggcgaccccaccgacgcgtcgggg
gccgagcgcagggttcgcatccagggcgtccgcaaggtcaccgcccaggccatgaaggag
tccatcgacaccaaggcgctggtcaccagcttcatcacctgcgacgtcagccgcagcatg
gagctcgtcgacaagctccgcaaggaccgcaagttcaagggcctgcgcgtctccccgctc
accctgtggtgccgggccgcctgcctggcgatgacccgcacccccgtcatcaacgcccgg
tgggatgacgagtccggcgagatcgtctacaaccgcgacatcaacctcggtatcgccgcc
gccaccccgcgcggcctcatggtgccggtgctgcgcggggcccaggacatgaacctcctc
gagctcgcccaggagctcacccgcatcatcgccatcgccaaggaagaccggctcaccccg
tccgactactccggcggcaccttctcgatctccaatgtcggggtcttcggactggacgcc
ggcacccccgtcgtcaaccggaccgaatcggcgctgctggtgctcggcaccatcgcccgc
cggccctgggtgatcggcgagggggccgaggagaagatcgtgccccgctgggtcaccacc
atgagcctcggattcgaccaccgcctggtcgacggggagcagggttcgatcttcctccac
gacgtcgccgagatcctctcggagccggacacggcgctgctgtactag

DBGET integrated database retrieval system