KEGG   Propionibacterium acidipropionici: PACID_31130Help
Entry
PACID_31130       CDS       T02345                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PACID_31130
Enzymes [BR:pbo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PACID_31130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3286029..3287765
Genome map
AA seq 578 aa AA seqDB search
MPDKSVIVIGGGVCGLAAAHALARAGAVVTLIEASSRVGGQVRSEVLCDSGESGGFAAGE
RRAGQPGTHLVGADEIDEDEVVELGGGRRTSGSPASARTAATAPPRVVEMGAEAVPLRAP
GVAALVEELGLTASMTHPRPGPALLSSRRGAVPMPDGVTPTGPTRLLPTVRSQILSPSGL
LRAAAEPITGRRHIDGDVSVGEFIETRFGPQVARAVVDPLLGAIHAADINRFSLAAAAPA
LVETAAEGDSMLLGTLGREARRAAGWARGLPLRGYHRMIRMMGLQEEDLDRQAPAPSLAS
WPRGTATLADRLAASVRARGTLLLNTRATRLTPPNDGGTAWRVGVEGLDGARELTADAVV
VATGSASAAGMLADVSPRAAEILAGLRAVSVATVILDLPLDETLAAHPLSGAATWFIGSG
WSPLIRQVTNLSHKWPTTLGGDRLVLRVSAGRDGGRPLDAMTDDDLARAVVAELRRLGLP
VAAPAEAVTVPSKDARRRMCTLVARFPNAMPQPAPGHRGRMESLAAALSEVPGLGLGGCA
TDGAGVGTAILAGRRLARQISAFLDRDPRDPREQGGTL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgacaagtccgtgatcgtgatcggcggtggggtatgcggcctggccgcagcccac
gcgctcgcgcgcgccggcgccgtggtgactctgatcgaggcgtcctcccgggtcgggggc
caggtgcgctcagaagtcctgtgcgattcgggggaatcgggcggattcgccgcgggcgaa
cgccgcgccggccaacccggcacccacctggtcggcgccgatgagatcgacgaggacgag
gtcgtcgagctgggaggcgggaggcggacctccggatccccggcgtccgccaggaccgcg
gccaccgctcctccccgcgtcgtcgagatgggtgccgaggccgtcccgctgcgcgccccc
ggcgtcgccgccctggtcgaggagctggggctgaccgcctccatgacccatccgcggccg
ggacccgccctgctgtcgagccggcgtggcgcggtgccgatgcccgacggcgtcacaccc
accggccccacccggctgctgcccaccgtccgctcccagatcctctcccccagcggcctc
ctgcgggccgccgccgaaccgatcaccggccggcgtcacatcgacggggacgtcagcgtc
ggcgagttcatcgagaccagattcggcccccaggtcgcccgcgccgtcgtcgaccccctg
ctgggagcgatccacgccgccgacatcaaccgcttcagcctggccgccgcggccccggca
ctggtcgagaccgccgccgagggggactcgatgctgctgggcaccctcggccgggaggcc
cggcgggccgccggctgggcgagggggctgcccctccgcgggtatcaccggatgattcgg
atgatgggtctgcaggaggaggacctcgaccggcaggcgcccgccccctcgctggcctcc
tggcccaggggcaccgcgacactggccgatcgcctggccgcttcggtgcgggcccgcggg
acactgctgctgaacaccagggccacccggctgacgcctcccaacgacggcgggacggcc
tggcgggtcggcgtcgagggcctcgacggcgcccgggagctcaccgccgacgccgtcgtg
gtggccaccggttccgcctccgcggccggcatgctggccgatgtgagcccccgggccgcc
gagatcctcgccgggctgcgcgcggtgagcgtggccactgtgatcctcgacctgcccctg
gacgagaccttggccgctcatccgttgtcgggggccgccacctggttcatcggctcgggc
tggtcgccgctcatccgccaggtgaccaacctgtctcacaagtggccgacaaccctcggc
ggcgaccgcctcgtgctgcgcgtgagtgcgggacgcgacggcggacggcccctggacgcc
atgaccgacgacgatctggcgcgcgccgtcgtcgcggaactgcgccgtctgggactgccg
gtcgcggccccggccgaggccgtcaccgtgccgtccaaggatgcccgcaggaggatgtgc
accctggtcgcccgcttcccgaacgccatgccacagccagccccggggcacaggggccgc
atggagtcccttgccgcagccctgtccgaggtgccgggactgggactcggagggtgcgcg
acagacggggccggagtcggcaccgccatcctcgccggccgtaggctggcccgtcagatc
agcgctttcctggaccgcgatccgcgcgatccccgcgaacaaggaggaaccctgtga

DBGET integrated database retrieval system