KEGG   Propionibacterium acidipropionici: PACID_31610Help
Entry
PACID_31610       CDS       T02345                                 

Definition
L-ribulose-5-phosphate 4-epimerase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pbo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3346279..3346935
Genome map
AA seq 218 aa AA seqDB search
MMLESERQSVVDACRFMQDKGLVVGTAGNVSIRVDDLVVISPSAVPYEELTAADVGVHRL
DGTPVEARLKPSSELPLHLSVYHATDVGAITHNHAPASTAMGLVCDEVPCSHYYSAMFGG
PIRVAPYAEFGTGDLARNVTDALADRKGALMSNHGAITTGPNLAKALDLLPYLEYICEVQ
LRAMWTGRPVKILSAEQMADAADGMSTYTPTSLDADHS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggaatccgaacggcagagcgtcgtcgacgcctgccggttcatgcaggacaag
ggactggtcgtgggaacggccggcaatgtctctatccgggtcgacgacctggtcgtcatc
tccccgtcagcagtgccctatgaggagctcaccgcagccgacgtcggcgtccaccgcctc
gacggcacaccggtggaggcgcggctcaagccctcctcggagctgcccctgcacctgagc
gtctatcacgccaccgatgttggcgcgatcacccacaatcacgccccggcgtccaccgcg
atgggcctggtgtgcgacgaggtgccctgttcgcactactactcggcgatgttcggcggc
ccgatccgggtggccccctacgccgagttcggcaccggggatctggcccgcaacgtcacc
gacgccctcgccgatcgcaagggggccctgatgagcaaccacggagcgatcaccacaggc
ccgaacctcgccaaggcgctggacctgctgccctacctcgagtacatctgcgaggtgcag
ctgcgggcgatgtggaccggacggccggtgaagatcctgtcggccgaacagatggccgat
gccgcggacggcatgtccacctacaccccgaccagcctggacgccgatcactcatga

DBGET integrated database retrieval system