KEGG   Propionibacterium acidipropionici: PACID_32100Help
Entry
PACID_32100       CDS       T02345                                 

Definition
glycoside hydrolase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PACID_32100
  Lipid metabolism
   00561 Glycerolipid metabolism
    PACID_32100
   00600 Sphingolipid metabolism
    PACID_32100
Enzymes [BR:pbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PACID_32100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3407898..3409943)
Genome map
AA seq 681 aa AA seqDB search
MIICWNPGPTGLRLEIPEDGPVRLLGVGPEPGPQPAQEGGRQPAQGAGLHSAAAPVRLVE
IALSADGHVVPTHAAHADYLTSQRLRHVSHDATDDALTVVQEDPRTGLRVTVLVKATASG
RVIHQQTVITNGGSAPQTLAYVSSAAITGVLHDEAGWRDARAHIGYNAWSGEFRWRALSL
EDVGLVNTGYPGSTGLNARFAQTGRGSWSSGDALPMGGLSRADGVAWAWQVENNGPWHWE
ISAQEPDLVVRMSGPTRDEHSWCWELEPGAQYSTAPVAIACSADGFEDALRALTEHRRAI
RRPNADDENLPVIFNDYMNALMGDPTTQREHTLIEAAAQAGAEYYVVDCGWYTDEKDWWD
LVGDWQESPRRFPGGLREVMDDVRAHGMVPGLWLEPEVIGKRSAAARTLPEDAFFHRDDT
RIVEKDRFQLDLRHPAAIAHLDAAIDRIVDVYGVGYLKFDHNINAAPGTGERVGEAMDGH
TRALSEWLDSLLERHPDLVIENCSSGGMRVDYAQLSRLSIQSTSDQQSPLLTATIAAAAP
SAVAPEQAAVWAYPQPGMSRGLLEFTLVNALMQRIHLSGHLDDVHPEQARIVADAITAYK
QIRHLIPVSLPSWPLGLPGWYDDVLALAMDGPAGELVSVWNRGDDAARLQLPLRSRGAAE
VRQVFPPAPSSTTGTRPECSP
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgatcatctgctggaacccgggccccaccggcctgcgcctcgagatccccgaggacggc
ccggtccggcttctcggcgtcgggccggagcccggcccgcagcccgcgcaggagggcggt
cggcagcccgcgcagggggccggtctgcacagcgcggcggcgcccgtgcgcctcgtggag
atcgccctgtcggccgacggccacgtcgtccccacccacgccgcccacgccgactacctc
acctcccagcggctccggcatgtcagccatgacgcgaccgacgatgccctcaccgtcgtc
caggaggatcctcggaccggcctgcgggtcacggtcctggtgaaggccaccgcatccggg
cgggtgattcaccagcagaccgtcatcaccaacggggggtccgcgccgcagactctggcc
tatgtgtcgtcggcggcgatcaccggcgtcctccacgacgaggccggttggcgcgacgcc
cgggcgcatatcggctacaacgcctggtccggggagttccgctggcgggcgctatcactg
gaggacgtcggcctggtcaacaccggataccccggctccacaggactcaacgcccggttc
gcgcagacgggacgaggatcgtggtccagcggagacgccctgccgatgggcggtctcagc
cgcgccgacggcgtcgcgtgggcctggcaggtggagaacaacgggccctggcactgggag
atcagcgcccaggagcccgacctcgtggtccggatgtcggggcccacccgcgacgagcac
tcctggtgctgggagctggaacccggggcgcagtattcaaccgcccccgtcgcgatcgcc
tgctccgcagacggcttcgaggacgcgctgcgggccctcaccgagcaccgccgggcgatc
cggcgtcccaatgccgacgatgagaacctgccggtcatcttcaacgactacatgaacgcc
ctcatgggcgatccgaccacccagcgcgagcacaccctcatcgaggccgccgcccaggcc
ggcgccgagtactacgtggtggactgcggctggtacaccgatgagaaggactggtgggat
ctggtcggcgactggcaggagtcgccgcgacgcttccccggcggcctgcgcgaggtgatg
gacgacgtccgtgcccacggcatggtgcccggcctgtggctggagcccgaggtcatcggg
aagcggtccgcggccgcccgcacactgcctgaggacgccttcttccaccgcgatgacacc
cggatcgtcgagaaggaccgcttccagctcgacctgcgccatccagcggcgatcgcccac
ctcgacgcggcgatcgaccggatcgtcgatgtctacggggtcggctatctcaaattcgac
cacaacatcaatgccgcaccggggaccggcgagcgggtcggggaggcgatggacggccac
acccgggcgctgtcggaatggctcgacagtcttctggagcgccacccggatctggtcatc
gagaactgctcctcgggaggcatgcgcgtcgactacgcccagctgagccggctgtccatc
cagtccacctccgaccagcagtcgccgctgctcactgcgaccatcgcggccgccgctccc
agcgccgtggcccctgagcaggccgccgtgtgggcctacccgcagccgggcatgagccgc
gggctgctggagttcaccctggtcaacgccctgatgcagcgcatccatctcagcggccac
ctggacgacgtccatcccgagcaggcgagaatcgtggcggacgccatcaccgcctacaag
cagatccgccatctcatccccgtctcgctgcccagctggccgctcggcctgccgggctgg
tacgacgacgtcctcgccctggccatggacgggccggcgggggagctggtctcggtgtgg
aaccggggggacgacgcggccaggctgcagctgccgctgagatccaggggcgccgctgag
gtacggcaggtcttccccccggcgccgtcgagcaccactgggacgaggccggagtgctca
ccgtga

DBGET integrated database retrieval system