KEGG   Parvularcula bermudensis: PB2503_00702Help
Entry
PB2503_00702      CDS       T01298                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pbr  Parvularcula bermudensis
Brite
Enzymes [BR:pbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PB2503_00702
Secretion system [BR:pbr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PB2503_00702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42456..43217)
Genome map
AA seq 253 aa AA seqDB search
MGSLRHNLSVGGVMIAAVTLASPSLAQETPDVQGKVAKRFTDTAVDAVDCEGFGPLCQVI
AGRTVFYVDEAVRHAFIGRVYDLEAKVDLTERTLAVIAPSADIEGAPAVGLRWADLPWDS
AIIRNEGGALKVAVFSDLHCGYCQRLSAALHDAPDIEAHEFLVGMAQSEGPSRAIGCAED
PEAALAAYYAARSLPAGSCDRDIVAPAREAAQRIGLTGTPTFLRPDGAVTAGFRDIDTLR
AWIAEGQAEETVQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtctgagacataatctgtccgtaggcggcgtgatgatcgctgcggtaacgctg
gcctcgccaagcctcgcgcaggagacgccggacgttcagggcaaggtcgccaagcgtttt
accgatacggcggtcgatgcggtcgactgcgagggcttcggcccgctctgccaggtcatc
gccggtcggactgtcttctatgtcgacgaggcggtgcggcacgcttttatcggccgcgtc
tatgatctcgaggccaaggtcgacctgaccgagcggaccctcgccgtgattgcgccgtct
gctgacatcgagggggcgcccgccgtcgggctccgctgggccgatttgccttgggacagc
gccattatccgcaatgaaggcggtgcgctgaaggtcgccgtcttctccgaccttcattgc
ggctactgccagcgcctctccgcggcgctgcacgacgccccggatatcgaagcccatgag
tttctggtcggcatggcgcagtcggaaggcccaagccgcgccattggctgcgcggaggat
cccgaagccgcgctcgcggcttactatgccgcgcgcagccttcctgccgggagctgcgac
cgggatatcgtcgcgccagcgagagaagcggcccagcgcatcggtctcaccggcacgccg
acctttttaaggcctgacggcgcggtgacggccggcttccgcgacatcgatactttgcgc
gcctggatcgccgaagggcaggccgaggagacggtccaatga

DBGET integrated database retrieval system