KEGG   Parvularcula bermudensis: PB2503_01122Help
Entry
PB2503_01122      CDS       T01298                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pbr  Parvularcula bermudensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PB2503_01122
Enzymes [BR:pbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PB2503_01122
Exosome [BR:pbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PB2503_01122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126541..127557
Genome map
AA seq 338 aa AA seqDB search
MPAYVFPGRFPSTRPRRLRSAPWIRDLVAETALRPQDLVLNLILRDETAAAGPIPAMPGI
ARHTVDEVVTRAEIAWEAGIKALALFPFTGPDSRSPGGEAALDADNLMCRAARGIKASLP
SIGLIADVALDPYTDHGHDGLLADGEILNDETVAVLCDQAALLAQAGFDTLAPSDMMDGR
VGAIRRRLDDDGYTDRLILSYAVKYASRFYGPYRDAIGSRGVLLGDKATYQMDPRNADEA
LKEAALDCAEGADILMVKPGLPYLDRIAAVKATFGLPVAAFQVSGEYAMLRCAADQGAFA
FAPAALEALICLKRGGADMIFSYYADEAARWLSDGLPS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcttacgtttttcccggtcgtttcccctccacccgtccgcgtcgattacgcagc
gccccgtggatccgtgaccttgtggcggaaaccgcgctcagacctcaggatttggtgctg
aacctcattttgcgggacgaaacagccgccgccggcccgatcccggctatgccggggatc
gcacgccatacggtcgacgaggtggtgacacgggccgaaatcgcctgggaagcggggatc
aaggctctagcgctctttccgtttaccggccccgacagtcggtcaccggggggggaggcg
gcccttgatgccgacaatttgatgtgccgtgccgcccgggggatcaaagcatcgctgcct
tccatcgggttaatcgccgatgtggccctcgacccctacaccgatcacggccatgatggg
cttcttgccgacggcgagatcctcaatgatgagacagttgctgtcctgtgcgaccaggcc
gcgctgcttgcccaagcggggttcgatacccttgccccttccgacatgatggacggacgg
gtcggcgccatccgccggcgcctcgacgatgacggctacaccgatcgactgatcctgtcc
tacgcggtcaaatacgcgtcgcgcttttacggcccctatcgcgatgccatcgggtcccgc
ggcgtcctgttgggggacaaagcgacctatcagatggatccgcggaatgctgacgaggcc
ctgaaagaggccgccctcgattgtgccgaaggcgccgacatcctgatggtcaagccgggc
ctgccctatctcgaccgtatcgccgcggtgaaggcgactttcggcctgccggtcgcggcg
ttccaggtctccggcgaatatgccatgctgcgctgtgcggccgatcagggggcctttgcc
ttcgccccggccgccctcgaagcgctgatctgcctcaaacgcggcggggccgatatgatc
ttcagttactatgccgacgaggcggcacggtggctgtcagatgggctgccgtcctga

DBGET integrated database retrieval system