KEGG   Parvularcula bermudensis: PB2503_01222Help
Entry
PB2503_01222      CDS       T01298                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pbr  Parvularcula bermudensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PB2503_01222
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PB2503_01222
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PB2503_01222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
151886..152437
Genome map
AA seq 183 aa AA seqDB search
MTDRPFDSIPLRTIAGDPLSLADFAGKVILIVNVASKCGLTPQYAALQALYEAKKDQGLV
ILGVPANDFAGQEPGTDEEIQTFCATTYDVDFPLLSKAVVTGPSKHPLYAALTDAQPVKT
GDADGFRAKLRSFGSEPTEDPEVLWNFEKFLIGKEGKVIGRFVPTTAPDDPALISAIDAA
LAA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccgtccctttgacagcattccgctccggacgatcgcgggggacccactgtcc
ctcgccgattttgccggaaaagttattttaatcgtcaatgtcgcctcaaaatgcggcctc
acgccgcaatatgcggcgcttcaggctctttatgaggccaaaaaggatcaggggctcgta
atcctgggcgtgccggcgaatgattttgccgggcaggagccggggacggatgaagagatc
cagaccttttgcgcgacaacctatgatgtcgactttccgcttctgtcgaaagcggtcgtg
accggccccagcaagcatcctctttatgcggcattgaccgatgcgcaaccggtcaagacg
ggggatgcggacggctttcgcgcgaaattgcgatcctttgggtccgagccgaccgaagac
ccagaagtgctctggaattttgagaaattccttatcggaaaagagggcaaagtgatcgga
cgatttgtcccgaccacagcccccgatgaccccgcattgatctcggccatcgatgcggcc
ctggccgcttga

DBGET integrated database retrieval system