KEGG   Parvularcula bermudensis: PB2503_01622Help
Entry
PB2503_01622      CDS       T01298                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
pbr  Parvularcula bermudensis
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    PB2503_01622
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     PB2503_01622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(242927..244594)
Genome map
AA seq 555 aa AA seqDB search
MGQNYSNNKQNIQKAAKQTKSGVSTGRRDLLKVGLASALSTSVLSAPAIARPFRQRERHR
AVIIGTGFGGAVTALRLAQAGIDVTLLERGIRWPSGPNGDTFPDFEGASKDPRTTWLSNA
PAFQPIGQGGVLPDKVLEKLFFKPFTGLQERVVGNGLDIICGAGVGGGSLTYQGVTMQPS
EAQFVADLPGLDYGKFDRDYYRRVEAMLRLAPIPDDLLYHPTYKAALQWHDRIAAAGETP
YRTRMPIDWSFAQAELRGEMKPVYTTGDLVFGVNNGGKFSLDKTYIAAAEATGRVSLKVL
HNVTDIHRDRWGRWLVDVDIIDTGGEVMQRKRLVTDALFLGAGSAGTTRLLMKAKAKDQI
ADLPDDVGGQWGNNGDRIFVWRPSDVSPGPQQGGPTAIALQDWDNPGGPLTLMQGPVPAK
VDVGVSTLVGFGPVSPGGYFTYDERKDDAVLNWDQAVDRELTQRITAKMQEVVGPDDLLF
DTTTAETTTWHPLGGAIMGKVCDLAGRVMGQTGLYVVDGALIAGSTGACNPSMTIAALAE
HCIETVLKEDLGRVF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtggggcagaattattccaataacaaacaaaatattcaaaaggctgcgaagcagaccaag
agcggcgtgagcactggccggcgagatctgttgaaagtcggtctggcctcggcgctctca
acgtcggttctgtcggccccggcgatcgcgcgaccgttcaggcagcgggaacgccaccgg
gcggtcatcatcgggaccgggttcggcggggccgtcaccgcgctcagactggcccaggcg
gggattgatgtgacgctcctggagcgcggcattcgctggccgtccggccccaatggtgac
acgtttccggatttcgagggagcctcgaaagatccgcgcacgacatggttgtccaatgcg
ccggcctttcaaccgattggccaggggggcgtcctgcccgacaaggtcctggagaagctc
ttcttcaaaccgttcaccggattgcaggagcgggtggtcggtaatggcctcgacatcatt
tgcggcgcgggcgtgggcggggggtccctgacctaccagggggtgacgatgcagccgagc
gaggcacaattcgtcgccgatttgccgggtctcgattatggaaaattcgatcgagattat
tatcgccgggtggaagccatgttgcgcctcgcgcccattcccgatgatctcctttaccat
cccacctacaaggctgccctgcaatggcacgaccgcatcgccgcggcgggggagacgcct
tatcgcacccgtatgccgatcgactggtcctttgcccaagcggaactccgtggggagatg
aagccggtctacaccacgggagatttggtgttcggcgtcaataacggtggaaagttcagc
ctcgacaagacctatatcgccgctgccgaagcgacgggcagggtgagcctcaaggtgctc
cacaatgtcaccgacatccatcgcgaccggtgggggcggtggctggtggatgtcgatatc
atcgacaccggcggtgaggtgatgcagcgaaagcgactggtcactgacgcgctattcctc
ggggcggggtcggcgggtacgacgcggctcttgatgaaagccaaggcgaaagatcagatt
gcagaccttcccgacgatgtcggcggccagtgggggaataatggcgatcggatctttgtc
tggcgcccctctgatgtcagccctggaccgcaacagggcggaccgaccgctatcgccctt
caggattgggataatcccggtgggccgctcaccctgatgcagggccccgttcctgcgaag
gtggatgttggggtgtcgactctcgtcgggttcggtcctgtctcccccggcggctatttc
acctatgacgagcgaaaagacgacgcggtgctgaactgggatcaagccgtggaccgagaa
ctcacccagcgcattaccgcgaagatgcaagaagtggtggggccggacgatctgcttttc
gacacgacgacggcggaaacgacgacctggcaccccctcggcggcgcgattatgggcaaa
gtctgcgatctggcgggccgggtgatgggccagaccggcctttacgtggtcgacggtgcc
ttgattgctggctccaccggggcgtgcaatccctcgatgaccattgcggcgctggctgag
cattgtatcgagacggtgctgaaagaggacctgggccgggtcttttga

DBGET integrated database retrieval system