KEGG   Parvularcula bermudensis: PB2503_01797Help
Entry
PB2503_01797      CDS       T01298                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pbr  Parvularcula bermudensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PB2503_01797
   00052 Galactose metabolism
    PB2503_01797
   00500 Starch and sucrose metabolism
    PB2503_01797
   00520 Amino sugar and nucleotide sugar metabolism
    PB2503_01797
Enzymes [BR:pbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PB2503_01797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281443..282261
Genome map
AA seq 272 aa AA seqDB search
MLPATKAVAKELLTVVDRPLIHYIADEAKEAGIEHLVFVTGRGKGAIEDYFDHAVELEQA
LEAKKKTAILEDTMSSLLAPGASSFTRQQAPKGLGHAIWCARDIVGDEPFAILLPDVIVQ
GPRGCLAQMVDQYEDGRNLVAVEAVPEDLVHKYGIVAPKGEIDGALFEMEGMVEKPEASA
APSNMSIMGRYILQPEVFSILEKTGKGAGGEIQLTDAMATLMDQQPFFAFQYEGESHDCG
SKLGFLKANIAYALENDELGADLKSWVSDRIA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggcgacgaaggccgtcgcaaaagaattgctgaccgtcgttgaccgtcctctg
atccattatatcgcggacgaagcaaaagaggcggggatcgagcatctcgtcttcgtcaca
gggcgcgggaaaggcgccatcgaggattatttcgatcacgcggtggagctagagcaggcg
ctcgaagcgaagaaaaaaacagcgatcctggaggacaccatgtcctctctgctggcaccg
ggcgcctcctcattcacccgtcagcaagcaccaaagggtctcggtcacgccatctggtgc
gcacgggatattgtcggcgatgagcccttcgccattttgctgcccgacgtcatcgtccag
gggccgcgcggatgcctggcgcagatggtcgaccaatatgaggacgggcggaaccttgtc
gccgtcgaagcggtgcccgaagatctcgtccacaaatacggcatcgttgcgccaaagggt
gagatcgatggggcgctgtttgagatggagggcatggtcgagaagccggaggccagcgcc
gccccatcgaatatgtcgatcatgggccgctatatccttcagccggaagttttctcgatc
ctcgaaaagacgggcaaaggcgccggcggcgagatccagctcaccgatgccatggcaacg
ctgatggatcagcagcccttcttcgccttccaatatgaaggggagagccacgattgcgga
tcgaaactcggctttcttaaggcgaatatcgcctacgctctcgaaaatgatgagttaggg
gccgacctcaagagctgggtcagcgatcgcatcgcctga

DBGET integrated database retrieval system