KEGG   Parvularcula bermudensis: PB2503_02377Help
Entry
PB2503_02377      CDS       T01298                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pbr  Parvularcula bermudensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PB2503_02377
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PB2503_02377
Enzymes [BR:pbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PB2503_02377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
401642..402598
Genome map
AA seq 318 aa AA seqDB search
MTALRHLTDVASLPEETFRRLLSRSLTIREMMDRGSFPAPVLDRRALVNLFFEDSTRTLM
SFEMAAKRLGAHTLTLPIANSSVKKGESLEDTVLTMCAQGADYLVIRARDQGTIARAIDV
IEQEGFLASVLNAGEGSFGHPTQGLLDAATMLRAIDRTPDQGLTGYKLAICGDVSHSRVA
ASTIEASACLGAEIVLGGPVALLPDAPPPGVQAMTSSVAEAVSGADFVMTLRLQKERMTK
ALDLSLEEYHRQYGLRHEVIAAANPGAFILHPGPANRNVEITDALADDPARSLIRSQVRQ
GVALRMALLEEIERGKSR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgttacgacatctgaccgatgtggcgtccctccccgaggagacgttccgtcgc
cttctttcccgatccctgaccattcgtgaaatgatggatcgcggctcttttccagcgccg
gtgctggaccgacgggccctcgtcaatctcttcttcgaggactcaacccggacgctgatg
tcctttgaaatggctgccaagcgcctcggcgcccacaccttgaccctgccgattgccaac
tcctcggtgaaaaaaggggagagccttgaggatacggtcctcaccatgtgcgcgcaggga
gcggattatctggtgatccgcgcccgcgaccagggaacgattgcccgggctatcgacgtg
atcgagcaggaggggtttctggcctccgtgctcaatgccggcgaaggctccttcggtcac
ccgacccaggggctgctcgatgcggccaccatgctgcgcgccatcgatcggacgccggat
caggggctcaccggctacaaattggcgatctgtggggatgtcagccattcccgggttgcc
gcctcgacgatcgaggcctcagcctgccttggcgcggagatcgtccttgggggaccggtc
gccctgcttcccgacgcaccgccgccaggggttcaggcgatgacatcgtcggtcgccgaa
gcggtgagcggggccgatttcgtgatgacgcttcgcctacagaaagagcgcatgacgaaa
gccctcgacctcagccttgaagaatatcatcgccagtacggccttcgccatgaggtcatc
gccgcggccaaccctggggccttcatcctccatcccggtcccgccaatcgaaatgtcgaa
atcaccgatgcccttgccgacgacccggcccggtccctaatccgcagccaagtccggcag
ggggtcgccctacgcatggcgctcttggaagaaatcgaaaggggaaaatcccgatga

DBGET integrated database retrieval system