KEGG   Parvularcula bermudensis: PB2503_02457Help
Entry
PB2503_02457      CDS       T01298                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00900  Terpenoid backbone biosynthesis
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01130  Biosynthesis of antibiotics
Module
pbr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PB2503_02457
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PB2503_02457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ADM08568
UniProt: E0TCD5
Position
complement(418125..419300)
Genome map
AA seq 391 aa AA seqDB search
MTLKRRVTVLGATGSVGTCTLKLVADTRRTAAAEIEVEALTAHTNAEALAALAIEHQASF
AAVADPGAGGRLAAALKGTGIAHGAGPEAVIEAAERDADWVMAAIVGAAGIKPLLAAAHR
GADIAFANKECLVCAGEAVLAAVAEGGGRLLPVDSEHNAIFQVFDFARPETVRRIVLTAS
GGPFRERPRDTFDQVTAAEAVSHPNWSMGAKISVDSATMMNKGLERIEAAYLFPVPKERI
EILVHPQSVIHSMVDYIDGSMLAQLGTPDMTIPIASALAWPERIPTGATPLDLAAVGRMT
FEPPDEQRFPALRQARESLEAGGLMTAVLNAANEVAVAAFLKGQVRFTDIAALTDHCLQT
VQPEGDPFTLEGVLEADRAARAAVKARALSL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacactcaaacggcgggttacggtcctcggcgccacgggctctgttgggacctgtacg
ctcaagctggtcgccgatacccgccggaccgcggcggcggagatcgaggtcgaagccctc
acggcgcacaccaatgccgaggccctggcggcccttgccatcgaacatcaggcctccttt
gcggcggtggcggatcccggtgccggcggccgtctggcagccgcgctcaagggcaccggc
attgcccatggggccggtcccgaggcggtgatcgaagctgccgagcgtgacgccgattgg
gtgatggcggccattgtcggggcggcgggcatcaagcctcttctagcggcggcccatcgc
ggcgccgatatcgcgtttgccaacaaggaatgtcttgtctgtgcgggggaggctgttctg
gcggcggttgccgaagggggcgggcggctcctccccgtcgacagcgagcataatgcgatc
ttccaggtcttcgacttcgcccggccggagacagtgcggcggatcgtgctcaccgcgtcg
ggcggaccgttcagagagcggcctcgggacaccttcgatcaggtgacggcggccgaggcg
gtgtctcaccccaattggtcgatgggggcgaaaatctcggtcgattcggccaccatgatg
aataagggccttgagcgcatcgaggcggcctatctgtttccggttccgaaggagcggatc
gagatccttgtccatccccaatcggtcattcactcgatggtggattatatcgacggctca
atgctggcccagctcgggacgccggacatgacgattccgatcgcttcggccttggcctgg
ccggagcggatcccgaccggcgccaccccccttgacctcgccgctgtggggaggatgacc
ttcgagccccctgacgaacagcgctttccggccctgcggcaagcgcgggagagccttgag
gcgggcgggctgatgacggcggtgctgaatgcggcgaacgaggtggccgtggcggccttc
ctgaagggacaggtccgctttaccgatatcgccgccctgaccgatcattgcctgcaaacc
gtccagcccgaaggggaccccttcaccctcgaaggggtcttggaggccgaccgcgcggcg
cgggccgctgtgaaggcgcgcgccctcagcctctga

DBGET integrated database retrieval system