KEGG   Parvularcula bermudensis: PB2503_02662Help
Entry
PB2503_02662      CDS       T01298                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pbr  Parvularcula bermudensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pbr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461729..462337
Genome map
AA seq 202 aa AA seqDB search
MIAALHGTVSVLSGENAIIDVNGVGYEVAATPRLLSSLAQGQEVRLITETLVAETYIRLV
AFQTIEERLTFRLLQTVQGVGAKAALAILSALTPADLFDAVEAGDKAMVARAQGVGPKLA
LRIVTELKGKCGGIVGAFPAVASPRATSAAAVDSPAEDAVAALVALGFDHGAARRTISTL
PDLETSRTEDLITAGLKTLAAS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgctcttcacggtacggtcagcgtcttgagcggcgagaacgccatcatcgat
gtcaacggtgtcggctatgaggtggcagcgacccctcggcttctctcctccctcgcccag
ggacaggaagtgcgcttgatcaccgaaacgcttgtggccgagacctatatccgactggtg
gccttccaaacgattgaggagcgcctcaccttccgcttgctgcaaacggttcagggcgtc
ggcgccaaggccgccctggcgatcctctccgcgctgacccctgctgatctattcgatgcg
gtggaggccggggacaaagccatggtggcgagagcccaaggggtgggccccaaactcgcc
ctacggatcgtcacggaactaaaagggaaatgcggcggcattgtcggcgcctttcccgcc
gtcgcctcaccaagggcgacgagcgcggccgccgtcgacagtccggcagaggatgccgtg
gccgctcttgtcgccctcggtttcgaccacggcgccgcgcggcgaaccatctcgaccctt
cctgatctcgaaacgtcccgcaccgaggatctcatcaccgccgggctgaaaacccttgcc
gcctcatga

DBGET integrated database retrieval system