KEGG   Parvularcula bermudensis: PB2503_03017Help
Entry
PB2503_03017      CDS       T01298                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pbr  Parvularcula bermudensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PB2503_03017
Enzymes [BR:pbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PB2503_03017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536432..537145
Genome map
AA seq 237 aa AA seqDB search
MTVFVTRPEPDATRTVAALASAELKAIPTPLLDIVIADAAAPPLAKGEALVFTSRNGVRA
WSATGGALTAPAYAVGTATAEAASEIGLTVADIGGGDVDTLLPVLMAAPATGFLHIRGRH
SRGQLVERLAATGRPARGIPLYEAKAATVLPAPLLDALRAGETPHGPCRIALFSPRTATI
LLRLLDDCLGRISVPAQIFCLSPAVAAALDKDRFAQVVIASEPTLPAFIDSLRSGST
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcttcgtcactcgacccgagcccgatgccacacgaaccgttgcggccctcgcg
tcggcggagctcaaggcgatccccaccccccttctcgatatcgtcatcgcggatgccgcc
gccccgccgctcgccaagggcgaagccctggtcttcacgtcgcgcaatggggtccgcgcc
tggtcggctaccggcggcgctctgacagcgccggcctacgccgtggggaccgcaaccgct
gaggccgcttctgagatcggtctgacggtggccgatatcggcggcggcgatgtcgacacc
cttctccccgtccttatggcggcgcccgccacaggatttttgcacattcgcggccgtcac
agccggggacagcttgtcgagcgattagcggccaccggccgcccggcgcgcggcatcccc
ctctacgaggcgaaggccgcaacggtcctccccgccccgcttctcgacgccttgcgcgcc
ggtgagacgccccacggcccttgccgcatcgcgcttttctccccccgaacggcgaccatt
cttctccgccttctcgacgactgccttggacggatttcggtgcccgcccaaatcttttgc
ctcagtccagctgtcgccgccgcattggataaggatcgtttcgcccaagtcgtcatcgcg
tctgaaccaacgctacctgctttcattgacagccttcgcagcgggagcacatag

DBGET integrated database retrieval system