KEGG   Parvularcula bermudensis: PB2503_03812Help
Entry
PB2503_03812      CDS       T01298                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pbr  Parvularcula bermudensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pbr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(691339..692427)
Genome map
AA seq 362 aa AA seqDB search
MTVTAPDLIESAKLAVVKVGSALITDTDHFTMGGLAGDIKERPWHAVLVSSGAVAVGNER
VPTLDPKQTEDRHALSAIGQATLITMWQSAFDAYNKVAAQVLLTPDVTDDRSRYLNARAA
LRALFDNGVIPIVNENDAVTTRDFRYGDNDRLAAKTAGLIGADLLIILSDVDGLYTSNPS
KDPDAKHVSYVPYGEASRYFEAAEDTKSGGVGTGGMRSKLAAARIAIDWGVTTIIASGRR
PHPLRDLVTGEARCTIFEAGDKISARRRWLSGVHERSGSMDIDAGALKALKAEASLLACG
VVQVAEPFLKGDVIDIRHDNQVVGFGLAACDSASIGSAEGSTIVLRRDDLILTEHDHDRN
DQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtaacggcaccagacttgatcgagagtgccaagctcgccgtcgttaaagtcggc
tcagcgctgatcaccgataccgatcacttcaccatggggggcctcgccggggatattaaa
gaacgtccctggcatgccgtcctcgtctcctccggggcggtcgccgtggggaacgagcgg
gtgccgaccctcgatcccaagcagaccgaagatcgccatgccctgtcggctatcgggcag
gcgaccttgatcacgatgtggcagtccgctttcgatgcctataacaaagtggctgcccag
gttttgctcacccccgacgtgacggatgaccgaagccgctatttgaacgcccgggcggcg
ctgagggcgctgttcgataatggcgtgatccccatcgtcaatgagaatgatgcggtgacc
acgcgggacttccgctatggcgacaatgatcgcctggccgcgaagaccgcagggctgatt
ggcgcggatctgttgatcatcctgtccgatgtcgacgggctctacacctccaatcccagc
aaggaccctgatgccaagcacgtttcctatgtgccctatggcgaggcgagccgatatttc
gaggccgcggaggatacaaagtccggcggcgttgggaccgggggcatgcgctcgaaactg
gctgccgcgcggatcgccatcgattggggcgtgaccacgatcatcgcgtcggggcgccgc
ccccatcctttgagggatctcgtcacgggggaagcgcgttgtactattttcgaggcgggg
gacaaaatatccgctcggcgccgctggctctcaggggtgcatgagcgttccggctcgatg
gatatcgatgcgggggcgctcaaggccttgaaagcagaagcaagcttactggcttgcggt
gtcgttcaggttgccgagccctttttgaagggggacgtgatcgacattcgtcacgacaac
caggtcgtcggtttcggccttgcggcgtgcgattcggcgagcatcgggtccgccgagggg
tcgacgatcgtccttcgccgtgacgacctcattttaacggagcacgaccatgacagaaac
gatcaatga

DBGET integrated database retrieval system