KEGG   Parvularcula bermudensis: PB2503_03832Help
Entry
PB2503_03832      CDS       T01298                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pbr  Parvularcula bermudensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pbr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
694914..695522
Genome map
AA seq 202 aa AA seqDB search
MSTLPVGPEIEQLLTIISRLPGFGPRSARRIALHLLRRREGVMVPLAEALATAAATVAPC
EICGNWDSQSPCRLCEDEERDGSVLCVVEDVGDVWALERSGAFKGRYHILGGLISPLDGI
GPDDLNFGPLSQRASAGTVREVILALSATVDGQTTAGYVADRLEGLGLTVTRLSHGVPIG
GELGHLDEGTLAAALQSRRDFS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagcacattgcccgtcggcccggaaatagagcagcttctgacgatcatttcacgtctg
ccgggttttggtccccgctccgcccggcgtatcgcccttcaccttttgcgtcggcgtgag
ggggtgatggtgcccttggccgaggccctggccaccgccgccgccactgtcgccccgtgc
gagatttgcgggaattgggacagtcaatcgccctgccgcctctgcgaggacgaagagcgg
gacggcagcgtactctgcgtggtcgaagatgtcggggatgtctgggccctggagcgatcc
ggcgccttcaaaggtcgctaccacattctcggcggcttgatttcgcccctcgatggcatc
ggacccgacgacctcaatttcggtcccctctcccaacgggcgagcgccggcaccgtgagg
gaagtgattttggcgctgtcggccacggtcgatggccagacgacggcaggctacgttgcc
gatcgccttgaaggcctgggcctgacggtgacccgactgagccatggggtgccgatcggc
ggggagcttggccatctcgacgaggggaccctcgccgccgcgctgcaaagccggcgggat
ttctcctaa

DBGET integrated database retrieval system