KEGG   Parvularcula bermudensis: PB2503_04587Help
Entry
PB2503_04587      CDS       T01298                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00260  Glycine, serine and threonine metabolism
pbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01130  Biosynthesis of antibiotics
pbr01230  Biosynthesis of amino acids
Module
pbr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PB2503_04587
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PB2503_04587
Enzymes [BR:pbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PB2503_04587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA NanE
Motif
Other DBs
NCBI-ProteinID: ADM08992
UniProt: E0TF74
Position
complement(845571..846398)
Genome map
AA seq 275 aa AA seqDB search
MSRLSDTFDALSREGRAAFIPFIMGGDPDFDTCRQLLDALPAAGADIIEIGVPFTDPMAD
GPAIQRAGQRALAGGQTLSKTLELVRSFRLKDDRTPLVLMGYYNPFYRFGIDRFLTAATE
AGVDGLIIVDLPPEEDEEFCKPAKEAGLDFIRLATPTTDDARLPAVLSHASGFVYYVSVA
GVTGGKTGEEASVERAVSRLKARSGLPVAVGFGVRTPERAATIAQTADAVVVGSALVEII
EAHRHDPCRVMDETIAFTRRLADSIKTARSERVSR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtttgtccgacacgttcgatgcgctctcccgcgagggtcgggccgctttcatc
cccttcatcatggggggagaccccgattttgatacctgtcgacaattgctcgacgccctg
cccgcagcgggggccgatatcatcgagatcggcgtccccttcacggacccgatggcggac
ggaccggcgatccaacgggccggtcaacgcgcccttgccggcggccagactctcagcaag
acccttgaattagtaaggtcgtttcgcctgaaggatgatcggacccccttggtgttgatg
gggtattacaatcccttttatcgcttcggaatcgatcgctttctcaccgcggcgaccgaa
gcgggggtcgacggtctgatcatcgtcgatctgccccccgaagaagatgaagagttctgc
aagccggcgaaagaagccggtctcgacttcatacggttggcgaccccgaccaccgacgat
gcgcgcttacccgccgtcctctcccacgcatcgggctttgtctattatgtgtccgtcgcc
ggggttacgggcggcaagacgggggaagaagcgagtgtcgagagggcggtgagccgcctt
aaagcgcgctcaggtctgcctgtcgccgtaggatttggggtaaggacccccgaacgcgcc
gcgaccatcgcccaaaccgccgacgccgtcgtggtgggctccgccctggtggagatcatc
gaagcccatcggcatgatccttgccgtgttatggacgaaacgattgcatttacccggcgt
ctcgccgactctattaagaccgcgcggtctgaaagggtatcccgatga

DBGET integrated database retrieval system