KEGG   Parvularcula bermudensis: PB2503_04597Help
Entry
PB2503_04597      CDS       T01298                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PB2503_04597
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PB2503_04597
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PB2503_04597
Enzymes [BR:pbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PB2503_04597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(846763..848025)
Genome map
AA seq 420 aa AA seqDB search
MTATDTLPPNSFRNGPDQRGRFGIFGGRFVAETLMPLILSVERAYEEAKADPDFQATIDR
YARDYVGRPSPLFEAERLTAHVRETAPTGKGARIFFKRDELNHTGAHKINNCLGQVLLAH
RMGKTRIIAETGAGQHGVATATVCALFGLPCTVFMGATDVERQKPNVFRMKLLGAEIVPV
TSGRGTLKDAMNEALRDWVTNVDNTFYVIGTAAGPHPYPAMVRDFQSVIGREARAQILER
EGRLPDTIMACIGGGSNAIGLFHPFLDDQDVEIIGVEAAGRGLETSDHAASLAGGAPGVL
HGNRTFLLQDEDGQIAEGHSISAGLDYPGIGPEHAWLHTTGRVTYQNATDREALDMFALL
SRLEGIIPALEPAHALARAVDKAAQLPQSALLLLNLCGRGDKDIFSVAAHLGVDIDPPGH
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgacaccctgcccccgaacagcttccgcaacggccccgatcagcgggga
aggttcggtattttcggaggtcgtttcgtagcggaaaccttgatgcctctcatcctttcg
gtggagcgcgcctatgaagaggcaaaggccgatcccgattttcaagccacgatcgatcgc
tatgcccgcgactatgttggtcgcccctccccactcttcgaagcggagcgcctgacggcc
catgtccgtgaaacagccccgacgggaaagggcgcgcgcattttcttcaagcgcgatgag
ctgaaccacacgggcgctcacaagatcaataattgcctcggccaggtcttgcttgcccat
cgcatgggcaaaacgcgcatcatcgcggaaaccggggcgggccagcatggggtggccacc
gccaccgtctgcgccctttttgggcttccctgcaccgtgtttatgggcgcgacggatgtc
gaacggcaaaagccgaatgtcttcaggatgaagttgctcggcgcggagattgtgccggtg
acgagcgggcgcggcaccctaaaagatgcgatgaacgaggcgttgcgcgactgggtgacg
aatgtcgacaacaccttctacgtgatcggcaccgcagccggcccccacccctaccccgcc
atggtccgcgactttcaatcggtgatcggccgggaggcgcgggcccagatccttgagcgg
gaggggcggctgccggatacgattatggcctgtatcggcggcgggtcgaacgcgatcggc
ctcttccacccctttctcgacgaccaagatgttgagatcatcggggtcgaggcggcgggg
cgcgggctggaaacgagcgatcacgccgcatcactcgccgggggagcgccgggggtgctg
cacggcaaccgtaccttcctcctccaggatgaggacgggcagattgccgaaggccattcg
atttctgcggggctcgattatccaggaattgggcctgaacatgcctggctccacaccacc
ggacgggtgacctatcagaatgccaccgacagggaggccctcgacatgttcgccctgctc
tcgcgccttgagggcattatccctgcgctggagcctgcgcacgccctcgctcgtgccgtt
gataaagcggcccaattgccccaatcggcgctgctattgctcaatctctgtgggcgcggc
gacaaggatatcttctccgtggcggcccatctgggggtcgatatcgacccccccggtcac
tag

DBGET integrated database retrieval system