KEGG   Parvularcula bermudensis: PB2503_04747Help
Entry
PB2503_04747      CDS       T01298                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pbr  Parvularcula bermudensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pbr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pbr00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pbr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(875926..877182)
Genome map
AA seq 418 aa AA seqDB search
MSVIARTLGISLAVLALAACETTAPVGPTDPMAGETANTGSTTSAEPGDADTGPTDLRPG
QASASGPSLTLTPIIPMLSKPLPPETRLTRIAFGSCLKQEDDQSIWQTVEASDPDLFLFI
GDNVYGDIYSGDPAMPELRSAYNTLAKSTPFASLRANVPVMAVWDDHDYGLNDAGGTFAL
KYGTEALFEEAWALPADDPRRARDGVYTSDIVGPSGERVQIILLDTRFFRDDLLPTDQRN
APGKERYLPDPDRSKTMLGEAQYAWLVKELQKPADLRIIVSSIQVIAEGHGWEAWNTLPA
ERQRLYDTIGASGAEHVILLSGDRHAGGLYKTHRALPYPLYEITSSSLNAPASVWRAQSG
ETRMEAGPNRLGPMMYEANFGLIDIDWSRRMVTLSLADATGAPAQAIKVSFAELQISD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgattgcccgcacactcggtatcagcctcgccgtcctcgctctcgccgcttgc
gaaaccaccgccccggtggggccgaccgatcccatggcaggtgaaaccgccaacaccgga
agcacgacatctgccgagccgggcgatgccgacacaggccccacggatttaaggccgggg
caggccagcgcgtccggcccttcgctcaccctcaccccgatcattccgatgctgtcaaag
ccgctcccgccggagacacggctgacccggatcgctttcggctcctgcctcaaacaagaa
gacgatcagtcgatctggcagacggtcgaagcgagcgaccccgatctgttcctgtttatc
ggcgacaatgtctacggcgatatctattcaggtgacccggcgatgcccgagctccgctcc
gcctataataccctcgccaagagcacaccctttgcctcccttcgggcaaatgtgccggtc
atggcggtatgggacgaccatgattacggcctcaacgatgcgggcggcacctttgcgttg
aaatatgggaccgaagccctgttcgaagaggcctgggccctgcctgcggacgatccacgc
cgcgcgcgggacggcgtttatacaagcgacatcgtcggcccgtcgggggagcgtgtgcag
atcatcctgctggacacccgctttttcagggacgacctgctgcccaccgatcagcgaaat
gcgccggggaaggagcgatatctccccgatcccgaccggtccaagacgatgctcggcgag
gcgcaatatgcctggctggtgaaggaactccagaagcccgccgatctccgcatcattgtg
tcctccatccaggtcatcgccgaaggccatggctgggaggcgtggaacacgctgccggcg
gaacgccagcgcctgtatgatacgatcggcgcatcgggggcggagcatgtcatcctgttg
tcaggcgaccgccacgccggcgggctttataaaacccatcgtgccctgccctatccgctt
tacgaaatcacctcttcgtccctcaatgccccagcctcggtctggcgcgcgcaaagcggc
gaaacccggatggaggccggaccgaaccgccttggcccgatgatgtatgaggcgaatttc
ggtctgatcgacatcgactggtcgcgccggatggtgacgctgtccctcgccgatgcgacg
ggggcgcccgcccaggcgatcaaggtgtcgtttgcggagctgcaaatttctgactga

DBGET integrated database retrieval system