KEGG   Parvularcula bermudensis: PB2503_04772Help
Entry
PB2503_04772      CDS       T01298                                 

Definition
proline dehydrogenase
Orthology
K13821  
proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
pbr  Parvularcula bermudensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pbr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pbr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
883595..886699
Genome map
AA seq 1034 aa AA seqDB search
MEATKMSLPVFNADYAPDDFAFARSLLARNAIPDPQKAKIKKRALRYVEAIRHAPKGAGL
EDFMQEYSLSTKEGLALMVLAEALLRIPDEETQDKLIADKLGTGDWEAPDGDESWLLMAA
SWGIGLSARIVRPGDTPGGVIQGLIRRVGGPAVRVGTRQAMNYLGRNFVLGQTIEDALDR
ARKQEKKGYRYSYDMLGEAARTYDDAERYRESYAGAIAAIGQRAKANMPPADRPGISVKL
SALTPRYFLKNSEELYEKLLPMVLALAEQAKAEDLNFTMDAEEADRLEVSLDIFRALTEA
PSLAGWDGLGLAVQAYQKRAPEVIQYVDTLAKESGRRFTVRLVKGAYWDTEIKRAQERGI
ENFPVFTRKTVTDLCYLDCARLLLDARPRLFPQFATHNAVTMAAIVEMGGNDGYEFQRLH
GMGEVLYDAQVHDDGIPVRIYAPVGGYKDLLAYLVRRMLENAANSSFVAQISDERISNDD
LLELPQDELRESVDLGEAPIHPLIRLPHKLYPLRPNSAGRELGHRPHLAELSEAIEQFRG
PYEPLPALINAEAYRHEGALHPIRNPASTEKPIGEWRVSGTAVVDHAMSVAHDAFPKWNA
RPVEERGQLLRDFADRMEAQLPYLVSIIAHEAGRTVDDGIAEVREAVDFCRYYAQRAEEL
MVDQEMPGPVGELNMYHLEGRGVWAAISPWNFPLAIFVGQIAAAVATGNTVVAKPAPQTP
YIAWRVIEMWHEVGLPAGVVNLVLGAGETGQAMINHPALAGVVFTGSVPTAKAINRALAE
REGPIVPLIAETGGINAMIVDSTALPEQVADDVVGSAFRSAGQRCSALRILYVQEDVADH
MLEMIQGAAEALKIGPPKDLSVDMGPVIDTDAVERLDAHWNEISAKGKVRYKGQAPEGGT
FFAPRIVELENFRDLQSEAFGPILHVCRWKPSQLDEVIASIHETGFGLTFGIHSRLESRQ
RQLAAAAPTGNVYINRNMVGAIVGVQPFGGRGLSGTGPKAGGPLYLTRFCEEKHVCENTT
AAGGNASLIALSDE
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
ttggaggcgacgaaaatgtccttgccggtgttcaatgctgactatgcccccgacgatttc
gctttcgcccggtcgttattggcccgtaatgccatccccgacccccagaaggcaaagatc
aagaagcgtgccctccgctatgtcgaagcgatccgccatgcgcccaagggcgcggggctt
gaagacttcatgcaggaatattcgctgtcgaccaaagaaggcctcgccctcatggttctt
gccgaggcgctgttgcggattcctgacgaggaaacccaggacaagctgattgccgataaa
ttggggaccggcgattgggaggcgcccgacggcgatgagagttggctgttgatggcggcc
agctggggcattgggctgtccgcgcgtatcgtccgtccgggcgatacgcccggcggcgtg
atccaaggactgatccgacgggtcgggggtccggcggtccgggtcggtacccgtcaggcc
atgaattatcttggccgcaacttcgtcctgggacagacgattgaggacgccctcgatcgc
gcccgaaagcaggaaaagaagggctatcgctattcctacgatatgctgggcgaggcggca
cggacatatgacgatgccgagcgctatagggagtcctatgccggggcgatagccgccatc
ggtcagcgggccaaggcgaatatgccccccgccgaccggccggggatctccgtcaagctt
tcggcgctaacgccgcgatacttcctcaagaatagcgaggagctctacgaaaagctcctg
ccgatggtccttgcgctcgccgaacaggccaaggcggaggacctgaacttcaccatggat
gccgaagaagccgatcggctggaggtatccctcgatatcttccgtgcccttaccgaagcg
ccgtctttggccgggtgggacggcctcgggctcgccgtgcaggcctatcagaagcgggcg
cctgaggtgatccaatatgtcgacaccctggcgaaagagagcggacgacggttcaccgtt
cgtctggtcaagggcgcctattgggatactgaaatcaagcgcgcccaagagcgggggatt
gagaatttcccagtctttacacggaaaaccgtgacggatctgtgttatttggattgcgct
cgtctgttgctcgatgcgcggccccgtctgttcccgcaattcgcgacccataacgccgtg
accatggcggccatcgtggagatgggggggaacgatggatatgaattccagcgcctccat
ggcatgggcgaggttctctacgatgcccaggtccacgatgacggtatccccgtccgtatt
tacgcgccggtgggggggtataaggaccttctcgcctatctagtgcggcggatgcttgaa
aatgccgccaattcctccttcgtggcgcagatttccgacgagcggatatcgaacgacgat
ctcctcgaattgccgcaggatgagttgcgggaatccgtcgatctcggcgaggcgccgatc
catccgttaatccgcctgccccacaaactctatccattacgtcccaacagcgcggggcgg
gagcttgggcatcgtccccacctggccgagctgtcagaggcgatcgagcaattccgtggg
ccctatgagccgctgccggcgttgatcaacgcggaggcgtatcggcacgaaggggcgctc
cacccgattagaaacccggcgtcgacggaaaaaccgattggagaatggcgggtttccggc
acggcggtggtcgatcatgccatgtcggtggcgcatgacgccttccccaaatggaatgcc
cgacccgtggaggagcggggccaattgctgcgcgattttgccgaccggatggaggcgcag
cttccctatcttgtctcgatcatcgcccatgaggccggtcgcaccgtggatgacgggatc
gccgaagtacgggaagccgtcgatttctgccgctattatgcacagcgtgccgaagaattg
atggtcgaccaggaaatgcccggtccggtgggtgagctcaatatgtaccatcttgagggg
cggggcgtctgggccgccatctcgccctggaattttccccttgcgatctttgtcggccaa
attgccgccgctgtggcgacggggaataccgtggtggccaaacccgcgccgcagaccccc
tatatcgcctggcgtgtgattgagatgtggcacgaagtcggcttgccggccggcgtggtc
aatctcgtccttggggccggcgagaccggtcaagccatgatcaatcaccccgcccttgcg
ggggtggtcttcaccggctccgttccgacggccaaagcgatcaaccgtgcgctcgccgag
cgggaggggccgatcgttcccctgatcgctgaaaccggcggtatcaatgccatgatcgtc
gactcaacggctctccccgaacaggtcgctgacgatgtggtcggctcggcttttcggtcg
gccggacagcgctgttcggctttgcgtattctgtatgtgcaggaagatgtggccgaccat
atgctggagatgatccagggggcagcggaggcgctgaagattggtccccctaaagacctt
tcggtggatatgggaccggtgatcgacaccgatgccgtcgaacgtctcgatgcccattgg
aatgagatctcggccaagggaaaagtccggtataaaggccaagcccccgagggcgggacg
ttctttgccccccgtattgtagaacttgagaatttccgagatcttcaaagcgaagcattc
ggtcccattctccatgtctgccggtggaagccctcgcaactcgatgaggtcatcgcctca
attcacgagacgggctttgggctcaccttcggcatccactctcgtctcgagagccgccaa
cgccaattggcggcggccgcgccgacaggaaatgtctatatcaatcggaatatggtgggg
gcgatcgtcggggttcagccgttcggtggccgcggcctttctgggacgggaccgaaagcc
gggggccccctttatctcacccggttctgcgaagaaaagcatgtgtgtgagaacaccaca
gcggcggggggcaatgcgtcgctgatcgcgctcagcgacgaataa

DBGET integrated database retrieval system