KEGG   Parvularcula bermudensis: PB2503_04822Help
Entry
PB2503_04822      CDS       T01298                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pbr  Parvularcula bermudensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_04822
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PB2503_04822
   00650 Butanoate metabolism
    PB2503_04822
  Energy metabolism
   00190 Oxidative phosphorylation
    PB2503_04822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(896330..896668)
Genome map
AA seq 112 aa AA seqDB search
MSSKPTKHYIAQRFTALIQIPLVIWLVFGVIGHAGDTQDQFRVWLSEPLTASLMIIFILS
VFFHMHLGMGEVVDDYIHKPSSRSLLNRVNQLVALVLAVLAVFAVAAITFIA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgaaaccaaccaaacattacatcgcccaacgcttcaccgcgctgatccagatt
ccgcttgtcatctggcttgtcttcggcgtgatcggccatgcgggcgacacgcaggatcag
tttcgggtctggctgtctgaacccctgaccgcctcgctgatgattatcttcattctcagc
gtcttcttccacatgcatctgggcatgggagaagtcgttgacgactacattcacaaaccg
tcgagccgatcacttctcaatcgagtgaaccagcttgtcgccctagtccttgcggtcctt
gcggtctttgccgttgccgcgattaccttcattgcatga

DBGET integrated database retrieval system