KEGG   Parvularcula bermudensis: PB2503_04822Help
Entry
PB2503_04822      CDS       T01298                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00020  Citrate cycle (TCA cycle)
pbr00190  Oxidative phosphorylation
pbr00650  Butanoate metabolism
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01130  Biosynthesis of antibiotics
pbr01200  Carbon metabolism
Module
pbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PB2503_04822
   00650 Butanoate metabolism
    PB2503_04822
  Energy metabolism
   00190 Oxidative phosphorylation
    PB2503_04822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C Abhydrolase_9_N DUF1980 DUF2607
Motif
Other DBs
NCBI-ProteinID: ADM09039
UniProt: E0TFC1
Position
complement(896330..896668)
Genome map
AA seq 112 aa AA seqDB search
MSSKPTKHYIAQRFTALIQIPLVIWLVFGVIGHAGDTQDQFRVWLSEPLTASLMIIFILS
VFFHMHLGMGEVVDDYIHKPSSRSLLNRVNQLVALVLAVLAVFAVAAITFIA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgaaaccaaccaaacattacatcgcccaacgcttcaccgcgctgatccagatt
ccgcttgtcatctggcttgtcttcggcgtgatcggccatgcgggcgacacgcaggatcag
tttcgggtctggctgtctgaacccctgaccgcctcgctgatgattatcttcattctcagc
gtcttcttccacatgcatctgggcatgggagaagtcgttgacgactacattcacaaaccg
tcgagccgatcacttctcaatcgagtgaaccagcttgtcgccctagtccttgcggtcctt
gcggtctttgccgttgccgcgattaccttcattgcatga

DBGET integrated database retrieval system