KEGG   Parvularcula bermudensis: PB2503_04902Help
Entry
PB2503_04902      CDS       T01298                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00630  Glyoxylate and dicarboxylate metabolism
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01200  Carbon metabolism
Module
pbr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PB2503_04902
Enzymes [BR:pbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PB2503_04902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADM09055
UniProt: E0TFP0
Position
911378..912979
Genome map
AA seq 533 aa AA seqDB search
MTAFSEDVSQVSSLIKSYDGTWDGISAESVARMRAQNRFQTGLDIARYCAKIMREDMAAY
DKDPANYTQSLGCWHGFIGQQKMISIKKHFGSTKGRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALVEELYTFLRQADARELGMMFREIDAAKEAGDEAKAKAIQEQVDNYETHVVP
IIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKVTVPHEDFIAKV
RACRYAFLELGVEDGIIVTRTDSLGAGLTKQIAISHEPGDIGDQYNSFLDCEEVSAEDCT
SSDVLIKRDGKLLRPKRLPSNLYQFKPGTGADRCVMDCIYSLQNGADLLWIETEKPDVDQ
IGSMVDRIREVMPNAKLVYNNSPSFNWTLKFRQQVYDMWAEEGKDVSSYDRDRLMSVDYD
DSELSVKADELIQAFQREGAAKAGIFHHLITLPTYHTAALSTDNLAKRYFGDEAMLGYVK
NVQREEIRQSIACVKHQNMAGSDMGDDHKEYFAGDAALKAGGKDNTMNQFNNV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacagctttttccgaagatgtctctcaggtgagttcgctgatcaaatcctacgacggt
acgtgggatggtatttccgcggaaagcgtcgcgcggatgcgggcgcaaaaccggttccaa
accggcctcgacatcgcgcgctattgcgcgaagatcatgcgcgaggatatggccgcctac
gataaagacccggccaattacacccagtcgcttggctgctggcacggttttatcggtcag
caaaaaatgatttcgatcaagaaacattttgggtcgaccaaaggccgctatctttatctc
tccgggtggatggtcgccgcgcttcggtccgaattcggtccgctgcctgaccaatccatg
cacgagaaaacctctgtgcccgccctggtggaagagctttataccttccttcgccaggcc
gatgcgcgggaactcggcatgatgttccgtgaaatcgacgcggcgaaggaggctggcgac
gaagcgaaagccaaggcgatccaggagcaggtggacaattacgaaacccacgttgtgccg
attatcgccgatatcgatgccggcttcgggaatgccgaagcgacctatctcttggcgaaa
aagatgatcgaagccggggcctgcgcgctgcagatcgagaaccaggtttccgatgaaaag
cagtgtggccaccaggacggcaaagtcaccgttccgcacgaagatttcatcgcgaaggtg
cgggcgtgccgctatgccttcctggagctgggcgttgaggacggcattatcgtcacgcgg
acggactccctcggggccggcctcaccaagcagatcgcgatcagtcacgaaccgggcgat
atcggcgatcagtacaactccttcctggactgcgaagaagtcagcgcggaggattgcacg
agttcggacgttctcatcaagcgggacggcaaattgctgcgtccgaagcgtcttccgtcc
aacctctaccagttcaagccggggacaggcgcggaccgttgcgtgatggactgcatctac
tcgctgcaaaacggtgccgaccttctatggatcgagaccgaaaagccggacgtcgatcag
atcgggtcgatggtcgatcgtatccgcgaagtcatgccgaacgcgaagctggtctataac
aactcgccgtcgttcaactggacgctgaaattccgtcagcaagtctacgatatgtgggct
gaagaaggaaaagatgtctccagctatgatcgtgaccgtctgatgtcggtcgattacgat
gacagcgagctgtcggtgaaggccgatgaattgatccaggcgttccaacgggaaggcgcg
gccaaggcggggatcttccaccacctcatcaccctgccgacctatcacacggcggcgctg
tccacggacaatctcgccaagcggtatttcggtgacgaagccatgctgggctatgtcaaa
aacgttcagcgcgaagaaattcgtcagtcgatcgcgtgcgtcaagcaccagaacatggcc
ggatcggacatgggcgacgatcacaaagagtattttgccggcgatgccgctcttaaggct
ggcggtaaagacaacacgatgaaccagttcaacaacgtttga

DBGET integrated database retrieval system