KEGG   Parvularcula bermudensis: PB2503_06647Help
Entry
PB2503_06647      CDS       T01298                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pbr  Parvularcula bermudensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pbr00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1294612..1295457)
Genome map
AA seq 281 aa AA seqDB search
MVFPLLRSSASFGNMSTLPSTARLDDLIRLSLAAGDVIMEVRSRAFEVQEKADGSAVTAA
DQAAEEVITAGLNALDNSIPIIAEEAASEGKIPEAGSRFFLVDPLDGTKEFINKRDEFTV
NIALVVDGLPVMGVVFAPAKGILWAGDPDGAIRQKASGSPFALVGEPEPIRARDVPADGR
IAIASRSHRSPETDEALQKLKTGDIRSAGSSLKFCVIAEGEADVYPRLGRTMEWDTAAGH
AVLKAAGGRVHVFANGEEQGPLTYGKVERDYDNPHFIAWGA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttggtcttccctttgctgcgatcctccgccagtttcggcaatatgagcacgcttcccagt
accgcccgcctcgacgatctcatccgcctgtcgcttgccgcgggggacgtcatcatggag
gtgcgcagccgcgccttcgaggttcaggaaaaggccgacggctctgccgtcaccgccgct
gaccaagcggcggaggaggtcattaccgcaggtcttaatgcgctcgacaactcgatcccg
atcatcgccgaagaggcggcaagtgaggggaagatccccgaggccgggtcgcgcttcttt
ctcgtcgaccccctcgatgggaccaaggaattcatcaataaacgggacgaattcaccgtc
aatatcgcgctggtggttgacggcctccccgtgatgggcgtggtcttcgcccccgccaag
ggcattttgtgggccggcgatcccgacggggcgatccgtcaaaaggccagcgggagcccg
ttcgccctggttggggagcctgagcccatccgggcgcgggatgttcccgccgatggtcga
atcgcgatcgccagtcgtagtcaccgcagccccgaaaccgacgaagcgctccaaaagctg
aagaccggcgatatcagatccgcaggatcgtcgctgaaattctgcgtcatcgcagaggga
gaagcggacgtctatccgcggctgggccggaccatggaatgggataccgccgcaggccat
gcggtgttgaaagcggcgggcggccgggttcacgtctttgcaaatggcgaagagcagggg
cccctcacctatggcaaagtcgaacgggactacgacaacccccacttcatcgcctggggc
gcctga

DBGET integrated database retrieval system