KEGG   Parvularcula bermudensis: PB2503_06707Help
Entry
PB2503_06707      CDS       T01298                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PB2503_06707
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PB2503_06707
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PB2503_06707
Enzymes [BR:pbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PB2503_06707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304251..1305642
Genome map
AA seq 463 aa AA seqDB search
MPDMRYRSTRGGVTGQSFADVLLAGLAPDGGLFVPETYPSLSPARLEDLAGASFADAAAA
VLPLFIGQDTPHFADTAWDRFAHPATTPLVQMGADDFLLELVHGPTLAFKDVAMQWLGPM
FSDGLAKAGRQMTIVCATSGDTGGAAVEAMAGRQATRLCVLHPENRISEVQRRFMTTVAA
DNVMNLAVRGTFDDCQSLVKAMFADETFRHQVGLGAVNSINWARIIAQTIYYVTSSLTLS
RQGGVVHYAVPTGNFGDILAGWVAKRLGAPVGHLIVATNENDILTRCLSTGSYRPDRVVE
TQSPSMDIQVSSNFERLLFEASGGDADLVRHLMHQLKTEGGFDVPTQVLSTITEEFSAYR
VDEEATADKMATVFAQSGRLIDPHTAIGLAAAERGRQAGLQGPIVTLSTAHAAKFPAAVE
AATGVAPTLPPHVRDLFGRPEHMISVDAELEAVKGQILHSFAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacatgcgctatcggtcaacccgtggcggtgtgacggggcaaagcttcgcggat
gtgcttctggcggggcttgcgccggatggcggcctgttcgttcccgagacctatccgtcc
ctttcccccgcgcgtcttgaagatctcgccggcgcctccttcgcggacgccgccgcggcg
gtgcttcccttattcatcggtcaggatacgccgcattttgccgatacggcctgggaccgt
ttcgcccaccctgcgacgacgccgctagttcaaatgggggctgacgattttttgttggaa
ctcgtgcatggaccgacgctcgccttcaaagatgtggcgatgcagtggctcggcccgatg
ttttccgacggcctggccaaagccggccggcaaatgaccattgtctgcgccacatcgggc
gatacggggggcgccgcggtcgaggccatggccggacgccaggcgacgcggctttgtgtg
ctgcatcctgaaaaccgtatttccgaggtgcagcgacgcttcatgaccaccgtcgcggcg
gacaatgtgatgaatctcgctgtgcgcgggaccttcgacgattgccagagcctggtgaag
gcaatgttcgctgatgagacatttcgccatcaggtcggcctcggggctgtcaactcgatc
aactgggcccggatcattgcccagacaatttactatgtgacctcctctctcaccctgtct
cgccaaggcggggtggtgcattatgccgtgccgaccggcaatttcggcgacatcctcgca
ggatgggtggccaagcgccttggggcgccggtggggcatctcatcgtcgccacgaatgaa
aacgacattctgacccggtgcctatccaccggcagctatcgccccgatcgggtggttgag
acccagtcgccgtccatggatatccaggtctccagtaattttgagcggctgctgttcgaa
gcctccggcggggatgcggatctggtccgccatctcatgcaccagttgaagacggagggg
ggctttgacgtgcccacccaggtcttatccaccatcaccgaggaattcagcgcctatcgg
gtcgatgaagaggcgaccgccgacaaaatggcaacggtgtttgcccaaagcggccgactg
atcgacccccacacggccattggcctcgccgccgccgagcgggggcgccaggccggactt
caggggccgattgtcaccctctccaccgcccatgcggcgaagtttccagcggcggtcgag
gccgccacgggggtggccccgaccctgccgccccatgtccgcgatctgttcggtcgcccg
gagcatatgatttcggtcgatgccgagctggaggccgtcaagggccagattttgcatagc
ttcgccctgtga

DBGET integrated database retrieval system