KEGG   Parvularcula bermudensis: PB2503_06707Help
Entry
PB2503_06707      CDS       T01298                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pbr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pbr00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304251..1305642
Genome map
AA seq 463 aa AA seqDB search
MPDMRYRSTRGGVTGQSFADVLLAGLAPDGGLFVPETYPSLSPARLEDLAGASFADAAAA
VLPLFIGQDTPHFADTAWDRFAHPATTPLVQMGADDFLLELVHGPTLAFKDVAMQWLGPM
FSDGLAKAGRQMTIVCATSGDTGGAAVEAMAGRQATRLCVLHPENRISEVQRRFMTTVAA
DNVMNLAVRGTFDDCQSLVKAMFADETFRHQVGLGAVNSINWARIIAQTIYYVTSSLTLS
RQGGVVHYAVPTGNFGDILAGWVAKRLGAPVGHLIVATNENDILTRCLSTGSYRPDRVVE
TQSPSMDIQVSSNFERLLFEASGGDADLVRHLMHQLKTEGGFDVPTQVLSTITEEFSAYR
VDEEATADKMATVFAQSGRLIDPHTAIGLAAAERGRQAGLQGPIVTLSTAHAAKFPAAVE
AATGVAPTLPPHVRDLFGRPEHMISVDAELEAVKGQILHSFAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacatgcgctatcggtcaacccgtggcggtgtgacggggcaaagcttcgcggat
gtgcttctggcggggcttgcgccggatggcggcctgttcgttcccgagacctatccgtcc
ctttcccccgcgcgtcttgaagatctcgccggcgcctccttcgcggacgccgccgcggcg
gtgcttcccttattcatcggtcaggatacgccgcattttgccgatacggcctgggaccgt
ttcgcccaccctgcgacgacgccgctagttcaaatgggggctgacgattttttgttggaa
ctcgtgcatggaccgacgctcgccttcaaagatgtggcgatgcagtggctcggcccgatg
ttttccgacggcctggccaaagccggccggcaaatgaccattgtctgcgccacatcgggc
gatacggggggcgccgcggtcgaggccatggccggacgccaggcgacgcggctttgtgtg
ctgcatcctgaaaaccgtatttccgaggtgcagcgacgcttcatgaccaccgtcgcggcg
gacaatgtgatgaatctcgctgtgcgcgggaccttcgacgattgccagagcctggtgaag
gcaatgttcgctgatgagacatttcgccatcaggtcggcctcggggctgtcaactcgatc
aactgggcccggatcattgcccagacaatttactatgtgacctcctctctcaccctgtct
cgccaaggcggggtggtgcattatgccgtgccgaccggcaatttcggcgacatcctcgca
ggatgggtggccaagcgccttggggcgccggtggggcatctcatcgtcgccacgaatgaa
aacgacattctgacccggtgcctatccaccggcagctatcgccccgatcgggtggttgag
acccagtcgccgtccatggatatccaggtctccagtaattttgagcggctgctgttcgaa
gcctccggcggggatgcggatctggtccgccatctcatgcaccagttgaagacggagggg
ggctttgacgtgcccacccaggtcttatccaccatcaccgaggaattcagcgcctatcgg
gtcgatgaagaggcgaccgccgacaaaatggcaacggtgtttgcccaaagcggccgactg
atcgacccccacacggccattggcctcgccgccgccgagcgggggcgccaggccggactt
caggggccgattgtcaccctctccaccgcccatgcggcgaagtttccagcggcggtcgag
gccgccacgggggtggccccgaccctgccgccccatgtccgcgatctgttcggtcgcccg
gagcatatgatttcggtcgatgccgagctggaggccgtcaagggccagattttgcatagc
ttcgccctgtga

DBGET integrated database retrieval system