KEGG   Parvularcula bermudensis: PB2503_07067Help
Entry
PB2503_07067      CDS       T01298                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00071  Fatty acid degradation
pbr00280  Valine, leucine and isoleucine degradation
pbr00281  Geraniol degradation
pbr00310  Lysine degradation
pbr00362  Benzoate degradation
pbr00380  Tryptophan metabolism
pbr00410  beta-Alanine metabolism
pbr00640  Propanoate metabolism
pbr00650  Butanoate metabolism
pbr00903  Limonene and pinene degradation
pbr00930  Caprolactam degradation
pbr01040  Biosynthesis of unsaturated fatty acids
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01130  Biosynthesis of antibiotics
pbr01200  Carbon metabolism
pbr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PB2503_07067
   00650 Butanoate metabolism
    PB2503_07067
  Lipid metabolism
   00071 Fatty acid degradation
    PB2503_07067
   01040 Biosynthesis of unsaturated fatty acids
    PB2503_07067
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PB2503_07067
   00310 Lysine degradation
    PB2503_07067
   00380 Tryptophan metabolism
    PB2503_07067
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PB2503_07067
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PB2503_07067
   00281 Geraniol degradation
    PB2503_07067
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PB2503_07067
   00930 Caprolactam degradation
    PB2503_07067
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PB2503_07067
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PB2503_07067
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PB2503_07067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_binding_8 UDPG_MGDP_dh_N Pyr_redox_2 F420_oxidored NAD_Gly3P_dh_N DAO ApbA AlaDh_PNT_C 2-Hacid_dh_C Sacchrp_dh_NADP Peptidase_S49 Shikimate_DH Pyr_redox FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADM09479
UniProt: E0TEA4
Position
1390617..1392830
Genome map
AA seq 737 aa AA seqDB search
MSYNTFSFDVDSDGIALLTIDLPGQSMNVWNQDLVEDFEKMADDFISNDEIKGLVIQSGK
DTGFLAGADLNMISMIPPDADPQFIFDQNYRLQTILRKLETGGKPAKELEKNLAKAKPVA
VAVDGLALGGGMELVLAGHYKVASDSGKTQFGQPEVLVGLIPGAGGTQRIMRLAGVQNAI
EICTQGKNMDAEKAKRLGLIDEIAPKDEIVAKAKEWVKANPKVVQPWDQKSFKIPNGGGG
AMNPKIVPIFAGASAMTAGVTNHNYPAARRILSAVYEGSIVPMDVALRIESKYFTQCLME
PQSRNMIRTLFKNKTAAEKGMARPEGVEKTDLKKIGVLGAGMMGAGIAYVSAKAGLEVVL
IDREQEYAEKGKAYSEKLNEKGVKRGKLSKEKSEEMLARITPTTDYDHLKDVDLIIEAVF
EDPDVKAETIKKTEAIIPDSTVFATNTSTIPIGDLAEYSSRADKFIGIHFFSPVDKMPLV
EIIPHANGGDKALAVALDYVGKIKKTPIVVADARGFYCNSCVVPYLNEAARMVMEGINPA
LIDNGALHMGMPVGPLALMDETSQELGLNIARSRQKAEGENYKREPTEDLLELFVEELGR
KGKKVGKGFYEYPEDGSKKYFWPGLKEHYPLAEEQPTVEEVQERLLYVNLVAAARMYAQG
VVHDPQSADLGAIFGWGFCPWTGGPMSYIDMIGLDKFVETADKLATKHGWLYEPPEMFRE
LAKKGTTLYGEYDKKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgagctataatactttcagcttcgacgttgattccgacggcatcgctcttctgacgatc
gaccttccgggacagtcgatgaatgtctggaaccaggatttggtcgaagacttcgaaaag
atggccgacgatttcatctccaacgatgagatcaagggcctggttatccaatcgggcaaa
gacacaggctttttggccggtgccgatttgaacatgatctcgatgatcccgcccgatgcg
gatcctcaattcatcttcgatcagaattaccgcctgcaaactattcttcgtaagctcgaa
accggcgggaagccggcgaaagagctggagaagaacctcgccaaggcaaaacccgtggct
gtcgccgtggacggattggcgctgggcggcggtatggagctggttctggcaggccactat
aaggtcgcgtccgacagcgggaagacgcagttcggccagcctgaggttttggtcggtctt
attcccggtgccggggggacccaacgcatcatgcgccttgccggtgtgcagaatgccatc
gaaatctgcacccagggcaagaacatggatgcggaaaaggccaaacgtcttgggctgatc
gatgagatcgcgccgaaagacgagattgttgccaaagccaaggaatgggtgaaggccaat
ccgaaagtggtgcaaccctgggatcaaaagagcttcaagatccccaatgggggcggcggc
gccatgaacccgaagatcgtgccgatcttcgccggtgccagcgccatgaccgccggggtc
accaatcacaattaccccgcggcccggcgtatcctctcggccgtctacgaagggtccatc
gttccgatggatgtcgccctccgtattgagagcaaatacttcacccaatgcctgatggag
ccgcaatcccggaacatgatccggacgctgttcaagaacaagacggcggcggaaaagggc
atggcccgtccagaaggggtcgagaaaaccgacctcaaaaagatcggcgtcctgggtgcc
gggatgatgggcgcggggattgcctatgtatccgccaaggcgggtcttgaggtcgtcctg
atcgaccgggaacaggaatatgccgaaaagggcaaagcttattccgaaaagctgaacgag
aagggagtgaagcgcggcaaactttccaaggagaagtccgaggaaatgctggcgcgcatt
acgccgaccaccgactatgatcatcttaaggatgtcgatctgatcattgaggctgtgttc
gaggatccggacgttaaagccgaaaccatcaagaagaccgaggcgatcattcccgactca
acggtctttgcgaccaatacctcgacgattcccatcggcgatctggcggaatattcttcc
cgtgccgataaatttattgggatccacttcttctcgccggtggataaaatgcccctggtg
gaaatcatcccgcacgccaatgggggcgataaggcgttggccgtcgctctcgattatgtg
gggaaaatcaagaagacccccatcgttgtggccgatgcgcgcggcttctactgcaactct
tgcgtggtgccctatctcaacgaagcggcacgcatggtgatggaggggatcaaccccgcc
ttgatcgacaatggggcccttcatatgggcatgcctgttggtcctttggcgctcatggat
gagaccagccaagagctgggcctcaatatcgcgcgctcccgtcagaaagctgaaggtgag
aattataagcgcgagcctaccgaagacctgctcgaactcttcgttgaagagctggggcgt
aaagggaagaaagtcggcaagggcttctacgaatatcccgaggatggatcgaagaagtac
ttctggccgggcctcaaggagcattatccgcttgctgaggaacaaccgaccgttgaagag
gtgcaagagcgactgctctacgtcaatctcgtggcggcggcccggatgtatgcccagggt
gtggtgcatgatccacaatcggcggatctcggcgcgatctttggctggggcttctgtccc
tggaccggcggcccgatgagctacatcgatatgatcggtctcgataagttcgtcgaaacc
gccgacaaactggccacgaagcacggctggctctatgagccgccggaaatgttccgtgag
ctggcgaaaaaaggaacgaccctttacggtgagtacgataaaaaagcggcctaa

DBGET integrated database retrieval system