KEGG   Parvularcula bermudensis: PB2503_07569Help
Entry
PB2503_07569      CDS       T01298                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pbr  Parvularcula bermudensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pbr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pbr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1496010..1497068
Genome map
AA seq 352 aa AA seqDB search
MYRTRVLIVDDSHTMCALVQLELSSDPELEVVAVAHNARDARDAIDQFKPDVLTLDIEMP
GMDGLEFLSRVMKHRPTPVVMVSSLTARNKDLSVEALSRGAVDLFAKPGSGPGSRNVSFE
GLAQVVREAASAKVVSPHRREIASATPQITAASGGFDDKVIAIGSSTGGVDALLAVIGQF
PADCPPTVVTQHMPAGFTGSFANRLDANAAPEVVEARSGEVLQRGRVYLAPGGKTHLEVA
HAKKLICRLREAPPVNGHRPSVDVLFNSVANMAGANVVGAILTGMGADGAQGLLQIRNAG
GYTVGQDRETSVIYGMPRVAYEMGAVCTQLPLPDIASAILNACRRSSKRGVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaacgcgggtgctgattgttgatgacagtcatacgatgtgtgcactcgtacag
cttgagctctcttccgatcctgaactcgaggtcgttgcggtcgcgcataatgcgcgcgat
gcccgggatgccatcgaccaattcaaacccgatgtcttaaccctcgatatcgaaatgccg
gggatggatggacttgagtttctcagccgggtgatgaagcatcggccgacccctgtggtc
atggtgtcatccctcacggctcggaataaagacctttccgttgaggccctgtcccgcggc
gccgtcgaccttttcgccaagccaggttccgggccaggttcccggaatgtcagtttcgaa
gggttggctcaggtggtccgtgaggccgccagtgccaaggttgtctcgccgcatcggcgt
gaaatcgcttcggctacgccccaaatcactgcggccagcggcgggttcgacgacaaagtc
atcgccatcggatcgtcgacggggggagtcgatgcccttttggccgtgatcggccaattt
cccgcagattgtcccccgaccgtggtgacccaacacatgcccgctggctttaccggtagc
tttgccaatcgtcttgacgcgaacgccgcgccggaggtcgtcgaagcgcgctccggcgaa
gttctccagcgtggccgcgtctatctcgcgcctggggggaagacgcatcttgaggtggcg
catgctaaaaagttaatttgccgactgcgggaggcccctcccgtcaatgggcatcgcccc
tctgtcgatgtcctgttcaattctgtcgcgaacatggcgggggcgaacgtcgtcggggcg
atcctgactggaatgggcgctgacggggctcaggggcttttgcaaatcagaaatgccggc
gggtacacggttggccaggatcgcgagacctctgttatctacgggatgcctcgcgtcgcc
tatgagatgggcgcggtctgcacccagctcccgctcccagatattgcctcagctattctc
aacgcatgccgacgatcgtcgaaaaggggggtcgcgtga

DBGET integrated database retrieval system