KEGG   Parvularcula bermudensis: PB2503_08189Help
Entry
PB2503_08189      CDS       T01298                                 

Definition
(GenBank) FolA, dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00670  One carbon pool by folate
pbr00790  Folate biosynthesis
pbr01100  Metabolic pathways
Module
pbr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PB2503_08189
   00670 One carbon pool by folate
    PB2503_08189
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PB2503_08189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ADM09693
UniProt: E0TIA9
Position
complement(1623845..1624345)
Genome map
AA seq 166 aa AA seqDB search
MSPRISLVVAVADNGVIGKDGTLPWRMRDDLKWFKSVTTGKPIVMGRTTWESLGDPLPQR
RNIVVSRQLDNAPEGSEVFAELDEALTAAAGSGADEICVIGGAQLYTAAMARADRLYVTR
VHGTPEGDTLFTLPDETGWTRTILRRIEKGSHNDFDATVEQWDRKA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcggatcagccttgttgtggcggtcgccgacaatggcgttatcgggaaggac
ggcacccttccctggcggatgcgtgacgacctcaaatggttcaaatccgtcacgaccggc
aagccaatcgtcatgggccggacgacctgggaaagtctcggcgatcccctgccccagcgc
cggaatatcgtcgtcagccgccagcttgataacgcgcccgaggggagcgaggtgttcgct
gagctcgacgaggccctgaccgccgcggccgggagcggcgccgacgagatctgtgtgatt
ggcggcgcccaactctatactgccgcgatggcacgggccgatcgcctctatgtaacccgc
gttcacggcacgcccgagggagatacgctctttaccctgcccgacgagacagggtggaca
cggacgatccttcgccggattgagaagggctctcacaatgatttcgacgccacggtcgag
caatgggaccggaaggcctga

DBGET integrated database retrieval system