KEGG   Parvularcula bermudensis: PB2503_08204Help
Entry
PB2503_08204      CDS       T01298                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
pbr  Parvularcula bermudensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PB2503_08204
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PB2503_08204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1626076..1626525)
Genome map
AA seq 149 aa AA seqDB search
MRRSFLPLFLALSLCACGQPSGADAPAGPDLESLSPLAQKGLTLFRECGVCHNYQKGGRH
GVGPNLWGVVGAPAAQRDTFAYSRALERSGLIWTEDTLDRYLENPHEVVPGTRMAYRGMA
DPADRDALIAFLASLQDPPKLAPNDPASD
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgatcattcctccccctgtttctcgcccttagtctctgcgcctgcggtcagccc
tcgggcgctgacgcccccgccggacccgatcttgagagcctaagcccccttgcgcagaag
gggctgaccctcttccgcgaatgcggggtgtgccataattatcaaaaggggggacgccac
ggcgtgggccccaatctttggggcgttgtcggcgcccccgccgcccagcgggacacattc
gcctattctcgcgctctcgaacggtcgggcctgatctggaccgaggacacgttggaccgg
tatctcgaaaatccccatgaggtcgtgccgggcacccgcatggcctatcgcgggatggcg
gaccccgccgaccgggacgccctcatcgcctttctggcgagccttcaagatccccccaag
ctcgcccctaacgatccggcgagcgattag

DBGET integrated database retrieval system