KEGG   Parvularcula bermudensis: PB2503_08334Help
Entry
PB2503_08334      CDS       T01298                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pbr  Parvularcula bermudensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PB2503_08334
Enzymes [BR:pbr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PB2503_08334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1650673..1651494
Genome map
AA seq 273 aa AA seqDB search
MIDPSLQIVGILNVTPDSFSDGGRYKGLDAALSQAERLAAEGATIIDIGGESTRPGAKPV
ASAEEQSRVIPVIRALRRELPDIPLSIDTRRPETARAAMGEGASIWNDVSALTFAEDSLA
TAADLGVRVILMHAQGDPQTMQCAPRYTDVVEEVFAFLAARIAVCEAAGIPKNRLIVDPG
IGFGKTLDHNLALLSGLDRFTALGPPLLIGASRKRFIAALDREGPAAERLGGSVAAVIES
YRRGAKLFRVHDVAATRQALAVAAAISPPDEAL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacccgtccctacagattgtcggcattctgaacgtcacccctgacagcttttcg
gacgggggccgctataagggcctcgatgcggcgctgtcgcaggcagagcgattggcggcc
gagggggcgacgatcatcgatattgggggcgaatcgacccgtcccggagcgaagcctgtt
gcctcggccgaggagcaaagccgcgtcattccggtcatccgcgccttgcgccgagaactg
ccggacatcccgttgtcgattgacacgcggcgccccgaaaccgcccgcgcggcgatgggg
gagggggcgtcgatctggaatgacgtctccgccctgaccttcgccgaggacagcctcgcc
acggccgctgatcttggcgtccgggtcatcctcatgcatgcccagggtgatccccagacc
atgcaatgcgcgccgcgctataccgatgtggtcgaagaggtttttgcgtttctggccgcg
cggattgccgtgtgtgaggcggcggggatcccgaagaaccgtctgatcgtcgatcccggc
atcggttttgggaagacccttgaccacaatcttgccctcttgtcgggattggaccggttc
accgcccttgggcccccgctattgatcggcgcgtcccgcaagcgattcatcgccgctctc
gaccgcgaggggccggctgcggagcggcttggcggctcggtggcggcggtcatcgaaagt
tatcgtcgcggcgctaaactgtttcgcgtgcacgatgtggcggccacgaggcaggcattg
gccgtggccgcggcgatctcgccccctgatgaggctttgtga

DBGET integrated database retrieval system