KEGG   Parvularcula bermudensis: PB2503_08849Help
Entry
PB2503_08849      CDS       T01298                                 

Definition
(GenBank) dihydrolipoamide s-acetyltransferase protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00010  Glycolysis / Gluconeogenesis
pbr00020  Citrate cycle (TCA cycle)
pbr00620  Pyruvate metabolism
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01130  Biosynthesis of antibiotics
pbr01200  Carbon metabolism
Module
pbr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_08849
   00020 Citrate cycle (TCA cycle)
    PB2503_08849
   00620 Pyruvate metabolism
    PB2503_08849
Enzymes [BR:pbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PB2503_08849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N YqfD DUF2118 RAP1
Motif
Other DBs
NCBI-ProteinID: ADM09825
UniProt: E0TC32
Position
1765206..1766591
Genome map
AA seq 461 aa AA seqDB search
MPMPILMPALSPTMEEGTLAKWMVAEGDKISSGDVIAEIETDKATMEVEAVDDGIVGKIL
VESGTEAVKVNQMIGVLLEEGESADDIDLEALRSSVPTDAGEDNGAAKKDAAQSSKEATS
PPKESPSESQEPSADRSAPSPTSTPSGSQSSSADAKAEGERLFASPLARRIAEQEGLSLP
LIEGTGPRGRIVKRDVEKALEEGQAQPDGKGAVAGAGGGLDPRLYSPETYTAIKNDGMRK
TIAKRLNQSFNQEVPHFPLNIDIDLTQLLAARERINAASPEKGSEGTYKISVNDFIVKAS
AQALMVVPGANASFTEEAILRHHHADIGVAVAIDGGLITPIVWRAETKGLQAISEEIRDL
AGRARDKKLKPEEYQGGTFAVSNLGMFGIKSFASIVNTPHGAILSVGAGEDRPVVRNGEI
VVRPIMTVTLTCDHRVVDGATGAEFLAAFKRFCEEPASMLL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgccgatcctgatgcccgccctgtctccgacgatggaggaggggaccctcgcc
aaatggatggtcgcggagggggacaagatctcttcgggcgatgtaatcgctgagatcgag
accgacaaagccacgatggaggtcgaggcggtcgatgatggaatcgttggcaagatcctc
gtcgagagcggcacggaggccgtcaaggtcaaccagatgatcggtgtgctccttgaggag
ggggagagcgccgatgatatcgatcttgaggcgcttcggtcctccgtcccaactgacgcc
ggggaggataatggcgccgcgaagaaggacgcggctcagtcctccaaagaggcgacctcg
ccccctaaggaaagcccgtctgaaagtcaggagccgtctgcggatcggtcggcgccatcg
ccgacctcaacgccgtcgggctcacagtcatcgtccgccgacgcgaaggccgaaggtgag
cggcttttcgcctcgcccctcgcccgccgcattgccgagcaggaggggctttccctgccc
ctgatcgaggggacggggccacgggggcggatcgtcaagcgggatgtggagaaggcgctg
gaggaagggcaagcgcaacccgatggcaaaggggcggtggccggagccggcggtgggctc
gacccccgtctctactcgccggaaacctataccgccatcaaaaacgatgggatgcggaag
accatcgcgaagcggctcaaccagagtttcaatcaggaagttccgcatttccccctcaat
atcgatatcgatctgacccagcttttggcggcgcgggaacgtatcaatgcggcctccccc
gaaaaggggagcgaggggacctataagatttcggtcaacgattttatcgtcaaggcgagc
gcccaagccctcatggtcgtgccgggcgccaatgcgagctttaccgaggaggcgatcctt
cgccaccatcacgccgatatcggcgtggccgtcgccatcgatggcggcttgatcacgccc
atcgtctggcgggcggaaaccaaggggcttcaggcgatctcggaggagattcgggacctt
gccggtcgggcgcgggataaaaagctgaagcctgaggaatatcagggcggcacctttgcc
gtctccaatttgggcatgttcgggatcaagagttttgcctcgatcgtcaacacgccccac
ggggcgatcctttccgtcggcgcgggggaggaccggcctgtggtccgcaatggggagatt
gtcgtgcggccgataatgaccgtcacgctcacctgcgatcaccgagtggtggacggcgcc
acgggagcggaattcctcgcggcctttaagcggttttgcgaagaaccggcctcaatgctt
ctctga

DBGET integrated database retrieval system