KEGG   Parvularcula bermudensis: PB2503_08849Help
Entry
PB2503_08849      CDS       T01298                                 

Definition
dihydrolipoamide s-acetyltransferase protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_08849
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_08849
   00020 Citrate cycle (TCA cycle)
    PB2503_08849
   00620 Pyruvate metabolism
    PB2503_08849
Enzymes [BR:pbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PB2503_08849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1765206..1766591
Genome map
AA seq 461 aa AA seqDB search
MPMPILMPALSPTMEEGTLAKWMVAEGDKISSGDVIAEIETDKATMEVEAVDDGIVGKIL
VESGTEAVKVNQMIGVLLEEGESADDIDLEALRSSVPTDAGEDNGAAKKDAAQSSKEATS
PPKESPSESQEPSADRSAPSPTSTPSGSQSSSADAKAEGERLFASPLARRIAEQEGLSLP
LIEGTGPRGRIVKRDVEKALEEGQAQPDGKGAVAGAGGGLDPRLYSPETYTAIKNDGMRK
TIAKRLNQSFNQEVPHFPLNIDIDLTQLLAARERINAASPEKGSEGTYKISVNDFIVKAS
AQALMVVPGANASFTEEAILRHHHADIGVAVAIDGGLITPIVWRAETKGLQAISEEIRDL
AGRARDKKLKPEEYQGGTFAVSNLGMFGIKSFASIVNTPHGAILSVGAGEDRPVVRNGEI
VVRPIMTVTLTCDHRVVDGATGAEFLAAFKRFCEEPASMLL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgccgatcctgatgcccgccctgtctccgacgatggaggaggggaccctcgcc
aaatggatggtcgcggagggggacaagatctcttcgggcgatgtaatcgctgagatcgag
accgacaaagccacgatggaggtcgaggcggtcgatgatggaatcgttggcaagatcctc
gtcgagagcggcacggaggccgtcaaggtcaaccagatgatcggtgtgctccttgaggag
ggggagagcgccgatgatatcgatcttgaggcgcttcggtcctccgtcccaactgacgcc
ggggaggataatggcgccgcgaagaaggacgcggctcagtcctccaaagaggcgacctcg
ccccctaaggaaagcccgtctgaaagtcaggagccgtctgcggatcggtcggcgccatcg
ccgacctcaacgccgtcgggctcacagtcatcgtccgccgacgcgaaggccgaaggtgag
cggcttttcgcctcgcccctcgcccgccgcattgccgagcaggaggggctttccctgccc
ctgatcgaggggacggggccacgggggcggatcgtcaagcgggatgtggagaaggcgctg
gaggaagggcaagcgcaacccgatggcaaaggggcggtggccggagccggcggtgggctc
gacccccgtctctactcgccggaaacctataccgccatcaaaaacgatgggatgcggaag
accatcgcgaagcggctcaaccagagtttcaatcaggaagttccgcatttccccctcaat
atcgatatcgatctgacccagcttttggcggcgcgggaacgtatcaatgcggcctccccc
gaaaaggggagcgaggggacctataagatttcggtcaacgattttatcgtcaaggcgagc
gcccaagccctcatggtcgtgccgggcgccaatgcgagctttaccgaggaggcgatcctt
cgccaccatcacgccgatatcggcgtggccgtcgccatcgatggcggcttgatcacgccc
atcgtctggcgggcggaaaccaaggggcttcaggcgatctcggaggagattcgggacctt
gccggtcgggcgcgggataaaaagctgaagcctgaggaatatcagggcggcacctttgcc
gtctccaatttgggcatgttcgggatcaagagttttgcctcgatcgtcaacacgccccac
ggggcgatcctttccgtcggcgcgggggaggaccggcctgtggtccgcaatggggagatt
gtcgtgcggccgataatgaccgtcacgctcacctgcgatcaccgagtggtggacggcgcc
acgggagcggaattcctcgcggcctttaagcggttttgcgaagaaccggcctcaatgctt
ctctga

DBGET integrated database retrieval system