KEGG   Parvularcula bermudensis: PB2503_08999Help
Entry
PB2503_08999      CDS       T01298                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pbr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pbr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pbr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pbr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pbr00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pbr00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1792697..1793620
Genome map
AA seq 307 aa AA seqDB search
MGRTVFAVRLKAREYPTFEEAVGTAIEHAGVRPEWAAIAVAGPVENDRAQFTNVDWSVSA
DSLRSHFAFSEVHLLNDFEALGHYAATPDPSGLFVLRRGHPSSGAPRLVMGPGSGLGQSI
AIPRAGPFAPSVIAAEGGHTFLPIATDDEDRLRGRLHAALGHAPTTENVLSGSGLMRLTS
AMLGENAAAYPSAAALTGAALNGDEAARRVTTQFFNFLGSAVRNALYATGARGGVFLAGG
IVPRLIPLIAESQFLSRVTENDPCGAYLANIPITVIVAEGAALDGAWRALAAHRSLSGAN
GAALGFA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaacggtctttgccgttcgcctcaaggcgcgcgaatatcccacttttgaagaa
gcggtgggaaccgcgatcgagcatgccggtgtgcggcccgaatgggctgccattgcggtg
gccggtccggttgagaatgatcgagcccagtttaccaatgtggattggtctgtgagcgcc
gactccctgcggtcacactttgccttttcagaagtccatctgctgaacgatttcgaagct
ctcggccattatgcggcgacccccgatccgtctgggcttttcgtgctgcgccgtggacat
ccgagctctggcgcgccgaggctcgtcatggggcccggatcgggccttggtcagtccatc
gcgatcccgcgggcgggccccttcgccccctcggtgattgccgcggagggggggcatacc
ttcctacccattgcgaccgatgacgaggaccgcctgcgtggtcggcttcacgcggcgtta
ggtcacgcaccgacgacggagaatgtactttcgggcagtgggcttatgcggctcacgagc
gcgatgctcggggagaatgcagcggcctatcccagtgcggcggcgttgaccggcgcggct
cttaacggggacgaggcagctcgtcgggtgacgacgcaattcttcaattttctcggctcg
gccgtccgtaatgccctttatgccacgggggcacgggggggcgttttcctggcgggcggg
atcgtcccgcgattgatcccccttattgccgaaagccagttcctctcccgtgtgaccgaa
aacgatccgtgcggcgcttatctcgcaaacatccctatcactgtgatcgtcgccgagggg
gccgcgctcgatggtgcctggcgcgccctcgcggcacatcgctctctttcaggggcgaac
ggggccgccctcggcttcgcctga

DBGET integrated database retrieval system