KEGG   Parvularcula bermudensis: PB2503_08999Help
Entry
PB2503_08999      CDS       T01298                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_08999
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_08999
   00052 Galactose metabolism
    PB2503_08999
   00500 Starch and sucrose metabolism
    PB2503_08999
   00520 Amino sugar and nucleotide sugar metabolism
    PB2503_08999
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PB2503_08999
   00524 Butirosin and neomycin biosynthesis
    PB2503_08999
Enzymes [BR:pbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PB2503_08999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1792697..1793620
Genome map
AA seq 307 aa AA seqDB search
MGRTVFAVRLKAREYPTFEEAVGTAIEHAGVRPEWAAIAVAGPVENDRAQFTNVDWSVSA
DSLRSHFAFSEVHLLNDFEALGHYAATPDPSGLFVLRRGHPSSGAPRLVMGPGSGLGQSI
AIPRAGPFAPSVIAAEGGHTFLPIATDDEDRLRGRLHAALGHAPTTENVLSGSGLMRLTS
AMLGENAAAYPSAAALTGAALNGDEAARRVTTQFFNFLGSAVRNALYATGARGGVFLAGG
IVPRLIPLIAESQFLSRVTENDPCGAYLANIPITVIVAEGAALDGAWRALAAHRSLSGAN
GAALGFA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaacggtctttgccgttcgcctcaaggcgcgcgaatatcccacttttgaagaa
gcggtgggaaccgcgatcgagcatgccggtgtgcggcccgaatgggctgccattgcggtg
gccggtccggttgagaatgatcgagcccagtttaccaatgtggattggtctgtgagcgcc
gactccctgcggtcacactttgccttttcagaagtccatctgctgaacgatttcgaagct
ctcggccattatgcggcgacccccgatccgtctgggcttttcgtgctgcgccgtggacat
ccgagctctggcgcgccgaggctcgtcatggggcccggatcgggccttggtcagtccatc
gcgatcccgcgggcgggccccttcgccccctcggtgattgccgcggagggggggcatacc
ttcctacccattgcgaccgatgacgaggaccgcctgcgtggtcggcttcacgcggcgtta
ggtcacgcaccgacgacggagaatgtactttcgggcagtgggcttatgcggctcacgagc
gcgatgctcggggagaatgcagcggcctatcccagtgcggcggcgttgaccggcgcggct
cttaacggggacgaggcagctcgtcgggtgacgacgcaattcttcaattttctcggctcg
gccgtccgtaatgccctttatgccacgggggcacgggggggcgttttcctggcgggcggg
atcgtcccgcgattgatcccccttattgccgaaagccagttcctctcccgtgtgaccgaa
aacgatccgtgcggcgcttatctcgcaaacatccctatcactgtgatcgtcgccgagggg
gccgcgctcgatggtgcctggcgcgccctcgcggcacatcgctctctttcaggggcgaac
ggggccgccctcggcttcgcctga

DBGET integrated database retrieval system