KEGG   Parvularcula bermudensis: PB2503_09809Help
Entry
PB2503_09809      CDS       T01298                                 

Definition
4-Diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pbr  Parvularcula bermudensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pbr00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1963456..1964343
Genome map
AA seq 295 aa AA seqDB search
MSLSSWPALAKINLALHVGAPYRNGYHPVDTLCVYAAVGDRLSLVAGSAGRPLLTLEGRS
AHGLDAGPSNFVIKALELFRHRTGLSPDVSFHLRKDVPLASGVGGGTANGALALWLLNRH
HGDPLSPRQLMALAVGLGADGPLCLAPLVYGGGCWRGQGTGTLIAPGPVLPPLWLCLANP
GRAVPTADVFRAFDQAGPITAPLAIDLHPRLKGYKEVKNLVMGTRNDLEASAVGLEPTIG
EVITRLRRTPGCLAARMTGSGATAFGLFASCQAAQRAARHLRSSGYWSVSAPLST
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctcttcctggcccgccctggcaaagatcaatctcgccctgcatgtcggggcg
ccttatcggaacggctatcacccggtggataccctctgtgtctatgccgcggtgggcgat
cggttgtcactggtggcgggatcggcggggcggcctttgctgacccttgaggggaggtcg
gcccacggccttgatgcaggaccgtctaacttcgtcatcaaggcgcttgagctcttccgt
caccggacgggtctgtccccggatgtctcttttcacctgcggaaagacgtgccccttgcc
tccggcgttggcggcgggaccgccaatggcgcgttggcgctctggctcctcaatcgccac
catggcgatcccctgtcgccgcgacagctcatggcgcttgccgtcggccttggcgcggat
ggaccgctgtgccttgcgcccctcgtctatggggggggatgctggcgagggcaggggaca
gggaccctgatcgcccctggtcctgttctgccgccgctttggctctgccttgccaatccg
ggccgggcggtgcccacggccgatgtcttccgcgccttcgatcaggcgggtcccataacg
gcgcctttggcaattgatttgcatccccgtctaaaaggttacaaagaggttaaaaacctc
gtgatggggacacgaaacgaccttgaggcatccgccgtcggattggagccgacaataggt
gaagtcatcaccaggcttcgccgcacccctggatgtctcgcggcacgaatgacgggaagt
ggggcaacagcgtttgggctcttcgcttcatgccaggcggcccaaagggcggctcggcac
ttacggtcatcgggttattggtcagtatcggcgcccctatcgacgtaa

DBGET integrated database retrieval system