KEGG   Parvularcula bermudensis: PB2503_09809Help
Entry
PB2503_09809      CDS       T01298                                 

Definition
(GenBank) 4-Diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00900  Terpenoid backbone biosynthesis
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01130  Biosynthesis of antibiotics
Module
pbr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PB2503_09809
Enzymes [BR:pbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PB2503_09809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N TOBE
Motif
Other DBs
NCBI-ProteinID: ADM10014
UniProt: E0TDU8
Position
1963456..1964343
Genome map
AA seq 295 aa AA seqDB search
MSLSSWPALAKINLALHVGAPYRNGYHPVDTLCVYAAVGDRLSLVAGSAGRPLLTLEGRS
AHGLDAGPSNFVIKALELFRHRTGLSPDVSFHLRKDVPLASGVGGGTANGALALWLLNRH
HGDPLSPRQLMALAVGLGADGPLCLAPLVYGGGCWRGQGTGTLIAPGPVLPPLWLCLANP
GRAVPTADVFRAFDQAGPITAPLAIDLHPRLKGYKEVKNLVMGTRNDLEASAVGLEPTIG
EVITRLRRTPGCLAARMTGSGATAFGLFASCQAAQRAARHLRSSGYWSVSAPLST
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctcttcctggcccgccctggcaaagatcaatctcgccctgcatgtcggggcg
ccttatcggaacggctatcacccggtggataccctctgtgtctatgccgcggtgggcgat
cggttgtcactggtggcgggatcggcggggcggcctttgctgacccttgaggggaggtcg
gcccacggccttgatgcaggaccgtctaacttcgtcatcaaggcgcttgagctcttccgt
caccggacgggtctgtccccggatgtctcttttcacctgcggaaagacgtgccccttgcc
tccggcgttggcggcgggaccgccaatggcgcgttggcgctctggctcctcaatcgccac
catggcgatcccctgtcgccgcgacagctcatggcgcttgccgtcggccttggcgcggat
ggaccgctgtgccttgcgcccctcgtctatggggggggatgctggcgagggcaggggaca
gggaccctgatcgcccctggtcctgttctgccgccgctttggctctgccttgccaatccg
ggccgggcggtgcccacggccgatgtcttccgcgccttcgatcaggcgggtcccataacg
gcgcctttggcaattgatttgcatccccgtctaaaaggttacaaagaggttaaaaacctc
gtgatggggacacgaaacgaccttgaggcatccgccgtcggattggagccgacaataggt
gaagtcatcaccaggcttcgccgcacccctggatgtctcgcggcacgaatgacgggaagt
ggggcaacagcgtttgggctcttcgcttcatgccaggcggcccaaagggcggctcggcac
ttacggtcatcgggttattggtcagtatcggcgcccctatcgacgtaa

DBGET integrated database retrieval system