KEGG   Parvularcula bermudensis: PB2503_10064Help
Entry
PB2503_10064      CDS       T01298                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00020  Citrate cycle (TCA cycle)
pbr00310  Lysine degradation
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01130  Biosynthesis of antibiotics
pbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PB2503_10064
  Amino acid metabolism
   00310 Lysine degradation
    PB2503_10064
Enzymes [BR:pbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PB2503_10064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N HlyD_D23 HlyD_3 GCV_H TSP9
Motif
Other DBs
NCBI-ProteinID: ADM10065
UniProt: E0TEX2
Position
2011639..2013177
Genome map
AA seq 512 aa AA seqDB search
MTEIRVPTLGESVTEATVGEWLVKEGDRVSVDDPLVELETDKVSVSVPAPMAGVITSITA
KEGDTVELDALLGEIGEANGTKASSSASSSNGSEAAASSAPTNKDEGGEPIEVLAPSSGE
SVTEADVGEWLVKIGDQVAVDETLVSLETDKAAVDVSAPSAGTITEIRQKEGETVTPGTV
LAIITQGGGAVPETKSPEKASSAKPDPAAAKSASTTDRAALSPAPRRMIQENGLDPASIA
GSGKDGRITKGDVVSYLKDQEAKPTPTPSTPSPSAPRDLGEREERVKMSRLRQTIARRLK
ESQNTAAMLTTFNDVDMSAVMEVRSQYKDLFEKKHGVKLGFMSFFVKACVHALREIPDVN
AEIDGTDIIYKDHYDIGIAVGTEKGLVVPVLRDAEQKSLAEIEKGITDFGRRARDGQLSL
EEMQGGTFTITNGGVYGSLMSTPILNMPQSGILGMHRIEKRPIVVGNEIVVRPMMYLALS
YDHRIVDGKGAVTFLVRVKENLEDPQRLLLDL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacagagatccgggtaccgactttaggtgaaagcgtcacggaagcgaccgtcggcgaa
tggcttgtgaaagagggcgacagggtgtcggtcgacgaccccctggtggagctcgaaacg
gacaaagtgtcggtcagcgtcccggcccccatggcgggggtcatcacctcgatcacggcc
aaagaaggcgacacggtcgaactcgatgcgctgctcggcgaaataggtgaggcgaatggc
acaaaggcgtcctcctccgcctcttcgtccaatggcagcgaggccgccgcctcgagcgcg
ccgacaaataaggatgagggtggcgagccgattgaggttcttgccccctcttcaggggag
agcgtgaccgaggccgatgtcggcgaatggctcgtcaagattggcgaccaggtggcggtg
gatgagaccctggtcagtcttgagaccgataaggccgcggtcgatgtgtcggcgccatcg
gcgggcaccatcaccgagatccggcagaaagagggggagacagtgacccccgggacagtc
cttgccatcatcacccaaggtggcggagcggtgccggagaccaagtcacccgaaaaggcc
agctcggcgaagcccgacccggcggcggccaaatcggcgtcgaccacggacagagccgca
ctttcccctgcccctcgccgcatgatccaggaaaatggcctcgaccccgcctctattgct
gggagcggcaaggatggtcggatcaccaagggcgatgtcgtcagctatctgaaggatcaa
gaggcgaagccgacgcctacaccgtccaccccaagtccttccgcaccgcgcgatctcggt
gagcgggaggaacgggtcaaaatgtcccgtctgcgtcagacgatcgcccgtcgactgaaa
gaaagtcaaaacacagcggccatgctgacgaccttcaacgatgtcgatatgtcggcggtc
atggaggttaggtctcagtacaaagatctctttgagaagaagcatggggtaaagctcggc
ttcatgtcgttctttgtgaaagcctgtgtgcatgccttgcgggaaattcccgatgtcaat
gcggagatcgacggcacggatatcatttacaaagaccattacgatatcggcatcgccgtc
gggacggagaaggggcttgtcgtgccggtcctacgggacgctgagcaaaaatccctcgcc
gagatcgaaaaggggatcacggatttcggtcgccgcgcccgcgacggtcaattgtcgctt
gaggagatgcagggcggcaccttcacgatcaccaatggcggggtatatggctctttgatg
tcgacgccgatcctcaacatgccgcaatcggggatccttgggatgcaccgtatcgaaaag
cggccgatcgttgtggggaacgagatcgttgtcagaccgatgatgtatctggctctcagc
tacgatcaccgtatcgttgatggaaagggcgccgtgaccttcctggtgcgggtgaaagag
aatctggaagatccccagcggcttctcctcgatctgtga

DBGET integrated database retrieval system