KEGG   Parvularcula bermudensis: PB2503_10484Help
Entry
PB2503_10484      CDS       T01298                                 

Definition
phage related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pbr  Parvularcula bermudensis
Brite
Enzymes [BR:pbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PB2503_10484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2093060..2094148)
Genome map
AA seq 362 aa AA seqDB search
MHISGEGIELIKAFEGLRLDVYDDGVGIWTIGYGHTGAIEVDGKRYSSVAAAYDDLGPFS
ISEAYAEDLLREDLQVFVAGVDRALKVTPTQSMFDALVSLAFNIGVSAFSKSTAVKRHNK
RDFEGAAEAITWWNKAGGQVLTGLVRRRSAEAALYLRDVDELLDGGAVTSSAGKEAIEEN
SPRRSNPITTRTTAGAAAAGTAGAAGAGTVLLEDREKASGDGVTTKPVDEATPPAPPSTE
SEDATPSAPMDDPMDDNEASSASAPADQGGEDAPPAAEEAGQSDDTGTAAGEDVEGSPPP
AASPPADATTEATEETTTTSFSDTVTESDLTDAIVIAAGILAVLAAIYVIGARIDDWRKW
RR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcagcggcgagggcattgagctcatcaaggccttcgaggggttgcgcctcgat
gtctatgacgatggggtcggaatctggacgatcggctatgggcacaccggcgcgatcgag
gttgacggaaaacgctattccagtgtcgcggcggcctatgacgaccttggtcccttttcg
atcagtgaggcctatgccgaagatctgctgcgggaggatcttcaggtcttcgtcgcgggg
gtcgaccgggcgctcaaagtgacccccacccagtcgatgttcgatgccctggtttccctg
gccttcaatatcggcgtcagcgccttttcgaaatcgaccgccgtcaagcgccacaataaa
cgcgatttcgaaggcgccgccgaggccattacctggtggaacaaggcggggggccaggtc
ctcacgggccttgtccgccgccgcagcgccgaagcggcgctttatctgcgcgatgtcgac
gaattgctcgatggcggtgctgtaacaagctctgcgggcaaggaagccatagaggaaaat
agcccgcggcgctccaaccccatcacgacccgcacgacggcgggggccgccgccgcgggc
acggccggcgccgccggtgcaggcacagtgctgctcgaagatcgggaaaaggcatccggc
gacggcgtcacgacaaaacccgtcgacgaggccacgccgcctgccccgccatccaccgaa
agcgaagacgctacgccgtcggcgccaatggacgacccaatggacgacaatgaggccagt
tccgcctcagcgcccgctgaccaggggggcgaggatgcccctcccgccgcagaagaggcc
ggtcagtccgacgataccggcaccgccgccggggaagatgtcgaagggagccccccaccg
gcagcctcccccccggcggacgccaccacggaagccaccgaagagacaacgacgacaagc
ttcagcgatacggtgaccgagagcgatctgaccgacgcgatcgtcatcgccgccggaatc
cttgcggtccttgccgccatctatgtgatcggggcgcgtatcgacgactggcggaaatgg
cgcagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system