KEGG   Parvularcula bermudensis: PB2503_10484Help
Entry
PB2503_10484      CDS       T01298                                 

Definition
phage related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pbr  Parvularcula bermudensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2093060..2094148)
Genome map
AA seq 362 aa AA seqDB search
MHISGEGIELIKAFEGLRLDVYDDGVGIWTIGYGHTGAIEVDGKRYSSVAAAYDDLGPFS
ISEAYAEDLLREDLQVFVAGVDRALKVTPTQSMFDALVSLAFNIGVSAFSKSTAVKRHNK
RDFEGAAEAITWWNKAGGQVLTGLVRRRSAEAALYLRDVDELLDGGAVTSSAGKEAIEEN
SPRRSNPITTRTTAGAAAAGTAGAAGAGTVLLEDREKASGDGVTTKPVDEATPPAPPSTE
SEDATPSAPMDDPMDDNEASSASAPADQGGEDAPPAAEEAGQSDDTGTAAGEDVEGSPPP
AASPPADATTEATEETTTTSFSDTVTESDLTDAIVIAAGILAVLAAIYVIGARIDDWRKW
RR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcagcggcgagggcattgagctcatcaaggccttcgaggggttgcgcctcgat
gtctatgacgatggggtcggaatctggacgatcggctatgggcacaccggcgcgatcgag
gttgacggaaaacgctattccagtgtcgcggcggcctatgacgaccttggtcccttttcg
atcagtgaggcctatgccgaagatctgctgcgggaggatcttcaggtcttcgtcgcgggg
gtcgaccgggcgctcaaagtgacccccacccagtcgatgttcgatgccctggtttccctg
gccttcaatatcggcgtcagcgccttttcgaaatcgaccgccgtcaagcgccacaataaa
cgcgatttcgaaggcgccgccgaggccattacctggtggaacaaggcggggggccaggtc
ctcacgggccttgtccgccgccgcagcgccgaagcggcgctttatctgcgcgatgtcgac
gaattgctcgatggcggtgctgtaacaagctctgcgggcaaggaagccatagaggaaaat
agcccgcggcgctccaaccccatcacgacccgcacgacggcgggggccgccgccgcgggc
acggccggcgccgccggtgcaggcacagtgctgctcgaagatcgggaaaaggcatccggc
gacggcgtcacgacaaaacccgtcgacgaggccacgccgcctgccccgccatccaccgaa
agcgaagacgctacgccgtcggcgccaatggacgacccaatggacgacaatgaggccagt
tccgcctcagcgcccgctgaccaggggggcgaggatgcccctcccgccgcagaagaggcc
ggtcagtccgacgataccggcaccgccgccggggaagatgtcgaagggagccccccaccg
gcagcctcccccccggcggacgccaccacggaagccaccgaagagacaacgacgacaagc
ttcagcgatacggtgaccgagagcgatctgaccgacgcgatcgtcatcgccgccggaatc
cttgcggtccttgccgccatctatgtgatcggggcgcgtatcgacgactggcggaaatgg
cgcagatga

DBGET integrated database retrieval system