KEGG   Parvularcula bermudensis: PB2503_10594Help
Entry
PB2503_10594      CDS       T01298                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pbr  Parvularcula bermudensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PB2503_10594
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PB2503_10594
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PB2503_10594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2117638..2118429)
Genome map
AA seq 263 aa AA seqDB search
MFDDLKGRNAVITGSTSGIGLHYAQGLAALGVNVMLNGFGDEAKIEETRKDIADTYGVTS
LYNGADMTKPKEIAGLIAEAKDAFGRIDILINNAGVQKVSPIEDFPDEKWDQIIAINLSS
AFHTIKHTVPIMKAQNFGRIVNTASAHALVASPFKAAYVAAKHGIMGLTKTVALEVAENG
ITCNAICPGYVKTPLVEDQIADTAKARGMTEEEVKKKVMLEAQPTKEFVTYEQLNGLLAY
LCSDVGGGCTGTAYQIDGGWTAK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacgatctcaagggccgcaatgcggtcatcactggctccacctccggcattggc
ctgcactacgcccaagggctggccgcgctgggggtcaatgtcatgctcaacggtttcggc
gacgaggcgaaaatcgaagagacccgaaaggacattgccgacacctatggcgtcacgagc
ctctataatggggcggacatgaccaagcccaaggaaatcgccgggttgatcgccgaggca
aaggacgccttcggacggatcgatattctgatcaacaatgccggggtgcaaaaggtctcc
cccattgaagatttcccggatgaaaaatgggaccagatcatcgcgatcaatctgtcctca
gcctttcacacgatcaagcacaccgtcccaatcatgaaggcgcagaatttcggccggatc
gtcaacaccgcgtccgcccatgcccttgtcgccagtcctttcaaggcggcctatgtcgcc
gccaagcacggcattatgggactcaccaagaccgttgcccttgaggtcgcggagaacggc
atcacctgcaatgcgatttgtccgggctatgtgaaaactcccctcgtcgaggatcaaatc
gccgataccgccaaggcgcgcggcatgaccgaggaggaagtcaagaagaaggtcatgctc
gaagcgcagccgacgaaagaattcgtgacctatgagcagttaaacggactcctcgcctat
ctctgctccgatgtcggggggggatgtacgggcacggcgtatcaaatcgacggtggctgg
accgcgaaataa

DBGET integrated database retrieval system