KEGG   Parvularcula bermudensis: PB2503_10844Help
Entry
PB2503_10844      CDS       T01298                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_10844
   01230 Biosynthesis of amino acids
    PB2503_10844
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_10844
  Energy metabolism
   00680 Methane metabolism
    PB2503_10844
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PB2503_10844
Enzymes [BR:pbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PB2503_10844
Exosome [BR:pbr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PB2503_10844
  Exosomal proteins of melanoma cells
   PB2503_10844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2169977..2170684
Genome map
AA seq 235 aa AA seqDB search
MPRICLVRHGQSRWNLENRFTGWVDVDLTEKGEAEARRAGELMKAETFKPVRAFTSVQTR
AIRTLNIALHALDRLWVPVTKDYRLNERHYGGLTGLDKAETAVKHGEDQVKIWRRSYDTP
PPPLDDPSPFPSLTDERYAGIEVPKTESLKLTLDRVAPYWQSTIVPAISEGDLLIAAHGN
SLRALVKLLFAVGDDEITSVEIPTGNPLLVELNNQMRASSAKYLDDSRAQALPKI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtatttgcttggtgcgacacggtcaaagccgctggaacctcgaaaaccgcttt
accggatgggtcgatgtcgacctgaccgagaagggggaggcggaggcccgtcgggcaggg
gagttgatgaaggcggaaaccttcaagcccgttcgtgcctttacgtcggttcaaaccagg
gccatccgaaccctgaatattgcattgcatgccctcgaccggctttgggtgccggtgacc
aaggattatcgccttaatgagcggcattatggcgggctgaccgggctcgacaaggccgag
acggcggtcaaacacggcgaggatcaggtaaaaatctggcgtcggagctatgataccccg
ccgccgcccctcgatgatccttcgccctttccgtctctgacggatgaacgctatgccggt
atcgaggtccccaagacggagagcctgaagctcaccctcgaccgcgtggctccttattgg
caatcgaccattgtgcccgccatttccgagggcgatttgttgatcgccgcccatggcaat
tcgctcagggcgcttgtcaaactccttttcgccgttggcgacgatgagattacgtcggtc
gagattccaacgggcaatcccctcttggtggagttgaacaaccagatgcgggcctcctcg
gcaaaatatttggatgactcgcgcgctcaggcgttgccgaagatttga

DBGET integrated database retrieval system