KEGG   Parvularcula bermudensis: PB2503_10844Help
Entry
PB2503_10844      CDS       T01298                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_10844
   01230 Biosynthesis of amino acids
    PB2503_10844
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_10844
  Energy metabolism
   00680 Methane metabolism
    PB2503_10844
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PB2503_10844
Enzymes [BR:pbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PB2503_10844
Exosome [BR:pbr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PB2503_10844
  Exosomal proteins of melanoma cells
   PB2503_10844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2169977..2170684
Genome map
AA seq 235 aa AA seqDB search
MPRICLVRHGQSRWNLENRFTGWVDVDLTEKGEAEARRAGELMKAETFKPVRAFTSVQTR
AIRTLNIALHALDRLWVPVTKDYRLNERHYGGLTGLDKAETAVKHGEDQVKIWRRSYDTP
PPPLDDPSPFPSLTDERYAGIEVPKTESLKLTLDRVAPYWQSTIVPAISEGDLLIAAHGN
SLRALVKLLFAVGDDEITSVEIPTGNPLLVELNNQMRASSAKYLDDSRAQALPKI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtatttgcttggtgcgacacggtcaaagccgctggaacctcgaaaaccgcttt
accggatgggtcgatgtcgacctgaccgagaagggggaggcggaggcccgtcgggcaggg
gagttgatgaaggcggaaaccttcaagcccgttcgtgcctttacgtcggttcaaaccagg
gccatccgaaccctgaatattgcattgcatgccctcgaccggctttgggtgccggtgacc
aaggattatcgccttaatgagcggcattatggcgggctgaccgggctcgacaaggccgag
acggcggtcaaacacggcgaggatcaggtaaaaatctggcgtcggagctatgataccccg
ccgccgcccctcgatgatccttcgccctttccgtctctgacggatgaacgctatgccggt
atcgaggtccccaagacggagagcctgaagctcaccctcgaccgcgtggctccttattgg
caatcgaccattgtgcccgccatttccgagggcgatttgttgatcgccgcccatggcaat
tcgctcagggcgcttgtcaaactccttttcgccgttggcgacgatgagattacgtcggtc
gagattccaacgggcaatcccctcttggtggagttgaacaaccagatgcgggcctcctcg
gcaaaatatttggatgactcgcgcgctcaggcgttgccgaagatttga

DBGET integrated database retrieval system