KEGG   Parvularcula bermudensis: PB2503_10844Help
Entry
PB2503_10844      CDS       T01298                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pbr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pbr00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:pbr00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pbr00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2169977..2170684
Genome map
AA seq 235 aa AA seqDB search
MPRICLVRHGQSRWNLENRFTGWVDVDLTEKGEAEARRAGELMKAETFKPVRAFTSVQTR
AIRTLNIALHALDRLWVPVTKDYRLNERHYGGLTGLDKAETAVKHGEDQVKIWRRSYDTP
PPPLDDPSPFPSLTDERYAGIEVPKTESLKLTLDRVAPYWQSTIVPAISEGDLLIAAHGN
SLRALVKLLFAVGDDEITSVEIPTGNPLLVELNNQMRASSAKYLDDSRAQALPKI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtatttgcttggtgcgacacggtcaaagccgctggaacctcgaaaaccgcttt
accggatgggtcgatgtcgacctgaccgagaagggggaggcggaggcccgtcgggcaggg
gagttgatgaaggcggaaaccttcaagcccgttcgtgcctttacgtcggttcaaaccagg
gccatccgaaccctgaatattgcattgcatgccctcgaccggctttgggtgccggtgacc
aaggattatcgccttaatgagcggcattatggcgggctgaccgggctcgacaaggccgag
acggcggtcaaacacggcgaggatcaggtaaaaatctggcgtcggagctatgataccccg
ccgccgcccctcgatgatccttcgccctttccgtctctgacggatgaacgctatgccggt
atcgaggtccccaagacggagagcctgaagctcaccctcgaccgcgtggctccttattgg
caatcgaccattgtgcccgccatttccgagggcgatttgttgatcgccgcccatggcaat
tcgctcagggcgcttgtcaaactccttttcgccgttggcgacgatgagattacgtcggtc
gagattccaacgggcaatcccctcttggtggagttgaacaaccagatgcgggcctcctcg
gcaaaatatttggatgactcgcgcgctcaggcgttgccgaagatttga

DBGET integrated database retrieval system